Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34760 135 / 1e-42 SAUR-like auxin-responsive protein family (.1) AT2G21220 133 / 6e-42 SAUR-like auxin-responsive protein family (.1) AT4G38860 130 / 1e-40 SAUR-like auxin-responsive protein family (.1) AT4G36110 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) AT2G18010 119 / 3e-36 SAUR-like auxin-responsive protein family (.1) AT2G16580 119 / 3e-36 SAUR-like auxin-responsive protein family (.1) AT1G75580 119 / 3e-36 SAUR-like auxin-responsive protein family (.1) AT1G19830 106 / 4e-31 SAUR-like auxin-responsive protein family (.1) AT5G66260 91 / 3e-25 SAUR-like auxin-responsive protein family (.1) AT4G38840 88 / 4e-24 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041921 [exp] 164 / 5e-54 AT4G34760 144 / 7e-46 SAUR-like auxin-responsive protein family (.1) Lus10012189 [exp] 129 / 3e-40 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10007553 [exp] 129 / 5e-40 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1) Lus10024326 [exp] 123 / 1e-37 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1) Lus10012432 [exp] 122 / 3e-37 AT1G75580 164 / 9e-54 SAUR-like auxin-responsive protein family (.1) Lus10026296 [exp] 112 / 1e-33 AT4G34760 133 / 4e-42 SAUR-like auxin-responsive protein family (.1) Lus10034511 [exp] 107 / 1e-31 AT1G75580 161 / 9e-53 SAUR-like auxin-responsive protein family (.1) Lus10033159 [exp] 106 / 4e-31 AT1G75580 160 / 1e-52 SAUR-like auxin-responsive protein family (.1) Lus10012185 [exp] 92 / 2e-25 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G012800 [exp] 145 / 1e-46 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 142 / 2e-45 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 139 / 3e-44 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 121 / 3e-37 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 121 / 4e-37 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.004G166100 [exp] 91 / 5e-25 AT2G21210 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 91 / 6e-25 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 89 / 2e-24 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 88 / 4e-24 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165900 [exp] 87 / 7e-24 AT4G34770 99 / 9e-29 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10028466 pacid=23166178 polypeptide=Lus10028466 locus=Lus10028466.g ID=Lus10028466.BGIv1.0 annot-version=v1.0 ATGGCCATTTCAAGAAAAGGCAACAACAACAACAACTCTTATGTTCTGAGGCAAATCCTGAAGAAATGTTCGAGCTTCGGGAAGAGTAGTAATGGTGGCG GTGGTGGGTTACCGGAGGATGTTCCGAAGGGGCACTTTGCGGTGTATGTCGGGGAGAAGAGAAGCAGATACATAGTTCCGATATCGTGGTTGGAACATCC GGAGTTTCAGAGCTTGCTTGAAAGAGCTGAAGAAGAGTTTGGATTCAAACACGAGATGGGTCTCACCATTCCTTGTGAAGAAGTTGTCTTCATTTCTTTA ACTTCCTTGATCAGATGA
AA sequence Show only first row Show all	>Lus10028466 pacid=23166178 polypeptide=Lus10028466 locus=Lus10028466.g ID=Lus10028466.BGIv1.0 annot-version=v1.0 MAISRKGNNNNNSYVLRQILKKCSSFGKSSNGGGGGLPEDVPKGHFAVYVGEKRSRYIVPISWLEHPEFQSLLERAEEEFGFKHEMGLTIPCEEVVFISL TSLIR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34760			SAUR-like auxin-responsive pro...		Lus10028466 [exp]	0	1
					Lus10028932 [exp]	10.5	0.9971
AT3G21720		ICL	isocitrate lyase (.1)		Lus10031552 [exp]	15.0	0.9970
AT4G33840			Glycosyl hydrolase family 10 p...		Lus10020985 [exp]	15.9	0.9905
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10007280 [exp]	16.7	0.9864
AT3G24130			Pectin lyase-like superfamily ...		Lus10016678 [exp]	17.4	0.9954
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032263 [exp]	18.2	0.9970
					Lus10016593 [exp]	21.2	0.9970
					Lus10015929 [exp]	23.7	0.9970
AT3G14820			GDSL-like Lipase/Acylhydrolase...		Lus10017279 [exp]	23.7	0.9850
AT5G13620			unknown protein		Lus10017168 [exp]	25.9	0.9970

Compare expression of checked genes

Lus10028466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.