Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67100 45 / 1e-06 AS2 LBD40 LOB domain-containing protein 40 (.1) AT3G02550 44 / 2e-06 AS2 LBD41 LOB domain-containing protein 41 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G114500 [exp] 62 / 9e-13 AT3G02550 291 / 5e-99 LOB domain-containing protein 41 (.1) Potri.004G100100 [exp] 56 / 2e-10 AT3G02550 277 / 2e-93 LOB domain-containing protein 41 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028469 pacid=23166086 polypeptide=Lus10028469 locus=Lus10028469.g ID=Lus10028469.BGIv1.0 annot-version=v1.0 ATGGTGTCGGTGGAGACTGCGGAGGCTTCGCTGCTTTTCAGGACGGAGACGGAGCCCGGCGGCAAAACATCAGGCGGAGGAGGAGCTAATAAGGGAGCCA GCCTGGATGATGGCGTGGGCGCGGCGGGGGTTTTGTTGGAGCTGACGCTGGGGCTTGAGCCGATGACGATGGTGGGGCCATCACGTGCATGTCACGTGGT CCCGGTAAAGAAGAGGAGAGTGGAAGCGTGCGAGGATGACACGTGTAAAACGGAGCTTGGGCTGGACTATCCGGCTTGA
AA sequence Show only first row Show all	>Lus10028469 pacid=23166086 polypeptide=Lus10028469 locus=Lus10028469.g ID=Lus10028469.BGIv1.0 annot-version=v1.0 MVSVETAEASLLFRTETEPGGKTSGGGGANKGASLDDGVGAAGVLLELTLGLEPMTMVGPSRACHVVPVKKRRVEACEDDTCKTELGLDYPA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67100	AS2	LBD40	LOB domain-containing protein ...		Lus10028469 [exp]	0	1
AT3G10040	Trihelix		sequence-specific DNA binding ...		Lus10035582 [exp]	1.4	0.9277
AT1G67100	AS2	LBD40	LOB domain-containing protein ...		Lus10028470 [exp]	2.4	0.9247
AT5G12470			Protein of unknown function (D...		Lus10009956 [exp]	3.5	0.8699
AT4G10265			Wound-responsive family protei...		Lus10039761 [exp]	4.9	0.8494
AT3G54690		SETH3	Sugar isomerase (SIS) family p...		Lus10003549 [exp]	5.3	0.8455
AT4G10265			Wound-responsive family protei...		Lus10033731 [exp]	6.0	0.8985
AT3G23150		ETR2	ethylene response 2, Signal tr...		Lus10021212 [exp]	6.0	0.8381
AT2G30970		ASP1	aspartate aminotransferase 1 (...		Lus10000181 [exp]	7.5	0.8175
AT3G53390			Transducin/WD40 repeat-like su...		Lus10026500 [exp]	7.7	0.8222
AT4G10265			Wound-responsive family protei...		Lus10039753 [exp]	8.4	0.8643

Compare expression of checked genes

Lus10028469 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.