Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67100 205 / 1e-68 AS2 LBD40 LOB domain-containing protein 40 (.1) AT3G02550 201 / 1e-66 AS2 LBD41 LOB domain-containing protein 41 (.1) AT1G68510 187 / 1e-61 AS2 LBD42 LOB domain-containing protein 42 (.1) AT5G67420 168 / 1e-53 AS2 ASL39, LBD37 ASYMMETRIC LEAVES2-LIKE 39, LOB domain-containing protein 37 (.1) AT3G49940 166 / 9e-53 AS2 LBD38 LOB domain-containing protein 38 (.1) AT4G37540 161 / 3e-51 AS2 LBD39 LOB domain-containing protein 39 (.1) AT2G23660 56 / 2e-10 AS2 LBD10 LOB domain-containing protein 10 (.1.2) AT5G66870 54 / 1e-09 AS2 LBD36, ASL1 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) AT2G31310 53 / 1e-09 AS2 LBD14 LOB domain-containing protein 14 (.1) AT3G26660 50 / 6e-09 AS2 LBD24 LOB domain-containing protein 24 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019292 [exp] 170 / 2e-54 AT3G49940 259 / 8e-87 LOB domain-containing protein 38 (.1) Lus10011530 [exp] 170 / 3e-54 AT3G49940 260 / 2e-87 LOB domain-containing protein 38 (.1) Lus10018697 [exp] 149 / 9e-47 AT5G67420 190 / 9e-61 ASYMMETRIC LEAVES2-LIKE 39, LOB domain-containing protein 37 (.1) Lus10007758 [exp] 147 / 2e-45 AT3G49940 191 / 1e-60 LOB domain-containing protein 38 (.1) Lus10018993 [exp] 57 / 2e-11 AT3G26660 134 / 2e-41 LOB domain-containing protein 24 (.1) Lus10033843 [exp] 56 / 6e-11 AT1G07900 143 / 8e-44 LOB domain-containing protein 1 (.1) Lus10028986 [exp] 55 / 3e-10 AT3G11090 185 / 6e-61 LOB domain-containing protein 21 (.1) Lus10018275 [exp] 54 / 8e-10 AT1G31320 243 / 2e-83 LOB domain-containing protein 4 (.1) Lus10040638 [exp] 53 / 1e-09 AT1G31320 244 / 1e-83 LOB domain-containing protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G100100 [exp] 212 / 2e-70 AT3G02550 277 / 2e-93 LOB domain-containing protein 41 (.1) Potri.017G114500 [exp] 208 / 6e-69 AT3G02550 291 / 5e-99 LOB domain-containing protein 41 (.1) Potri.008G120600 [exp] 195 / 2e-64 AT1G68510 228 / 3e-75 LOB domain-containing protein 42 (.1) Potri.012G056800 [exp] 188 / 3e-61 AT3G02550 188 / 5e-59 LOB domain-containing protein 41 (.1) Potri.010G125000 [exp] 183 / 1e-59 AT1G68510 220 / 2e-72 LOB domain-containing protein 42 (.1) Potri.005G145500 [exp] 170 / 2e-54 AT5G67420 244 / 2e-81 ASYMMETRIC LEAVES2-LIKE 39, LOB domain-containing protein 37 (.1) Potri.007G053600 [exp] 169 / 2e-54 AT3G49940 263 / 3e-89 LOB domain-containing protein 38 (.1) Potri.002G119400 [exp] 155 / 3e-49 AT3G49940 198 / 5e-64 LOB domain-containing protein 38 (.1) Potri.014G017400 [exp] 155 / 5e-49 AT4G37540 196 / 4e-63 LOB domain-containing protein 39 (.1) Potri.009G089600 [exp] 152 / 8e-48 AT3G49940 195 / 7e-63 LOB domain-containing protein 38 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03195 [flax] [poplar] LOB Lateral organ boundaries (LOB) domain
Representative CDS sequence Show only first row Show all	>Lus10028470 pacid=23166139 polypeptide=Lus10028470 locus=Lus10028470.g ID=Lus10028470.BGIv1.0 annot-version=v1.0 ATGCGGATGAGCTGTAATGGATGCCGAGTCCTCCGCAAGGGCTGCAGCGACAACTGCAGCATCCGACCTTGCCTCCAGTGGATCAAATCGCCCGACTCCC AGGCTCACGCCACCGTCTTCCTCGCCAAATTCTACGGCCGCGCTGGCCTCATGAACCTCATCAACGCCGGCCCCGACCACCTCCGTCCTGCGATCTTCAG GTCCTTGCTATACGAGGCATGCGGCCGAATCGTCAACCCGATTTACGGTTCGGTCGGGTTGCTGTGGTCCGGGAGCTGGCATCTCTGCCAGGCAGCAGTG GAGGCCGTGCGTGAGAGCACGGTGTGA
AA sequence Show only first row Show all	>Lus10028470 pacid=23166139 polypeptide=Lus10028470 locus=Lus10028470.g ID=Lus10028470.BGIv1.0 annot-version=v1.0 MRMSCNGCRVLRKGCSDNCSIRPCLQWIKSPDSQAHATVFLAKFYGRAGLMNLINAGPDHLRPAIFRSLLYEACGRIVNPIYGSVGLLWSGSWHLCQAAV EAVRESTV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67100	AS2	LBD40	LOB domain-containing protein ...		Lus10028470 [exp]	0	1
AT1G67100	AS2	LBD40	LOB domain-containing protein ...		Lus10028469 [exp]	2.4	0.9247
AT3G10040	Trihelix		sequence-specific DNA binding ...		Lus10035582 [exp]	2.4	0.9261
AT3G10040	Trihelix		sequence-specific DNA binding ...		Lus10008643 [exp]	4.7	0.9293
AT4G10265			Wound-responsive family protei...		Lus10039753 [exp]	5.3	0.9067
AT4G10265			Wound-responsive family protei...		Lus10033731 [exp]	6.9	0.9089
AT1G09850		XBCP3	xylem bark cysteine peptidase ...		Lus10006130 [exp]	7.5	0.8803
AT1G74940			Protein of unknown function (D...		Lus10027642 [exp]	9.3	0.8605
AT4G10265			Wound-responsive family protei...		Lus10018532 [exp]	11.4	0.9107
AT5G39890			Protein of unknown function (D...		Lus10013620 [exp]	11.5	0.9119
AT3G03050		RHD7, ATCSLD3, ...	ROOT HAIR DEFECTIVE 7, KOJAK, ...		Lus10030455 [exp]	11.6	0.8988

Compare expression of checked genes

Lus10028470 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.