Lus10028471 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38430 245 / 6e-84 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
AT5G38420 245 / 6e-84 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
AT5G38410 244 / 1e-83 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
AT1G67090 244 / 1e-83 RBCS1A ribulose bisphosphate carboxylase small chain 1A (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009172 336 / 8e-120 AT5G38420 264 / 2e-91 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
Lus10017597 285 / 2e-99 AT5G38410 271 / 2e-94 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
Lus10033558 283 / 4e-99 AT5G38410 272 / 1e-94 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
Lus10005093 167 / 6e-53 AT5G38420 186 / 3e-60 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
Lus10034357 163 / 2e-51 AT1G67090 182 / 7e-59 ribulose bisphosphate carboxylase small chain 1A (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G114600 244 / 2e-83 AT1G67090 292 / 2e-102 ribulose bisphosphate carboxylase small chain 1A (.1.2)
Potri.004G100000 239 / 2e-81 AT1G67090 286 / 3e-100 ribulose bisphosphate carboxylase small chain 1A (.1.2)
Potri.018G091401 170 / 2e-54 AT5G38410 183 / 1e-59 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
Potri.006G167901 0 / 1 AT5G38410 0 / 1 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00101 RuBisCO_small Ribulose bisphosphate carboxylase, small chain
PF12338 RbcS Ribulose-1,5-bisphosphate carboxylase small subunit
Representative CDS sequence
>Lus10028471 pacid=23166004 polypeptide=Lus10028471 locus=Lus10028471.g ID=Lus10028471.BGIv1.0 annot-version=v1.0
ATGGCTTCCTTGATGTCTTCCTCCGGCGTCTCCACCGTCGGCAGAACCGCCGCAGTTCAGGCTAGCTTGGTCGCACCATTCAAGTCCTCCTCCTCCGCCT
TCCCGGTCACCAAGAGGTCCTCCAACCGTTCTACCATCCCAAGCAACGGCAGCAGAGTCCAGTGCATGAAGGTGTGGCCACCAGTTGGGTTGAAGAAGTA
CGAAACGCTGTCGTACCTTCCCCCATTGTCTGAGGAGTCTTTGGCTAAGGAGGTTGACTACCTACTCCGCATGGGATGGGTTCCTTGCTTGGAATTCGAG
TTGGAGCACGGTTTCGTGTACCGTGAGCACAACAGCTCGCCGGGGTACTACGACGGGAGGTACTGGACAATGTGGAAGCTGCCCATGTTCGGGTGCACCG
ACTCGTCGCAGGTGATGAAGGAGCTCCAGGAGTGCGTCAAGGAGTACCCGACCGCTTTCGTCCGTATCATCGGATTCGACAACAAGCGTCAAGTGCAGTG
TATCAGTTTCATTGCCGCCAAGCCCCCGGGCTACTAA
AA sequence
>Lus10028471 pacid=23166004 polypeptide=Lus10028471 locus=Lus10028471.g ID=Lus10028471.BGIv1.0 annot-version=v1.0
MASLMSSSGVSTVGRTAAVQASLVAPFKSSSSAFPVTKRSSNRSTIPSNGSRVQCMKVWPPVGLKKYETLSYLPPLSEESLAKEVDYLLRMGWVPCLEFE
LEHGFVYREHNSSPGYYDGRYWTMWKLPMFGCTDSSQVMKELQECVKEYPTAFVRIIGFDNKRQVQCISFIAAKPPGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G38420 Ribulose bisphosphate carboxyl... Lus10028471 0 1
AT1G11860 Glycine cleavage T-protein fam... Lus10001624 3.5 0.8987
AT1G23740 AOR alkenal/one oxidoreductase, Ox... Lus10030873 4.2 0.9142
AT2G20890 PSB29, THF1 THYLAKOID FORMATION1, photosys... Lus10039748 5.1 0.9193
AT5G51110 Transcriptional coactivator/pt... Lus10014182 8.9 0.8999
AT2G23670 YCF37 homolog of Synechocystis YCF37... Lus10022478 10.8 0.8960
AT5G51110 Transcriptional coactivator/pt... Lus10022731 13.6 0.9018
AT5G35630 ATGSL1, GLN2, G... GLUTAMINE SYNTHETASE LIKE 1, g... Lus10034016 14.7 0.8861
AT3G59400 GUN4 GENOMES UNCOUPLED 4, enzyme bi... Lus10033819 15.2 0.8961
AT2G30570 PSBW photosystem II reaction center... Lus10014751 16.0 0.9011
AT3G28920 ZF_HD ATHB34, ZHD9 ZINC FINGER HOMEODOMAIN 9, hom... Lus10034503 19.7 0.8756

Lus10028471 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.