Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47090 133 / 3e-37 Leucine-rich repeat protein kinase family protein (.1) AT3G47570 132 / 5e-37 Leucine-rich repeat protein kinase family protein (.1) AT5G39390 127 / 7e-36 Leucine-rich repeat protein kinase family protein (.1) AT5G20480 126 / 1e-34 EFR EF-TU receptor (.1) AT3G47110 125 / 1e-34 Leucine-rich repeat protein kinase family protein (.1) AT3G47580 124 / 5e-34 Leucine-rich repeat protein kinase family protein (.1) AT4G20140 95 / 1e-23 GSO1 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1) AT5G44700 92 / 7e-23 GSO2, EDA23 GASSHO 2, EMBRYO SAC DEVELOPMENT ARREST 23, Leucine-rich repeat transmembrane protein kinase (.1) AT5G46330 86 / 1e-20 FLS2 FLAGELLIN-SENSITIVE 2, Leucine-rich receptor-like protein kinase family protein (.1) AT4G39400 81 / 5e-19 DWF2, CBB2, BIN1, BRI1, ATBRI1 DWARF 2, CABBAGE 2, BRASSINOSTEROID INSENSITIVE 1, BR INSENSITIVE 1, Leucine-rich receptor-like protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006445 [exp] 202 / 1e-62 AT3G47570 468 / 1e-152 Leucine-rich repeat protein kinase family protein (.1) Lus10011386 [exp] 204 / 5e-62 AT3G47570 787 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10011388 [exp] 203 / 8e-62 AT3G47570 757 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10011387 [exp] 202 / 3e-61 AT3G47570 782 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030903 [exp] 182 / 1e-54 AT3G47570 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10016896 [exp] 181 / 7e-54 AT3G47570 714 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030845 [exp] 179 / 3e-53 AT3G47570 796 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10014500 [exp] 179 / 3e-53 AT3G47570 663 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030846 [exp] 177 / 2e-52 AT3G47570 749 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G273001 [exp] 158 / 4e-46 AT3G47570 635 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G115900 [exp] 152 / 5e-44 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G007866 [exp] 151 / 1e-43 AT3G47570 770 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G034000 [exp] 150 / 3e-43 AT3G47570 827 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G033900 [exp] 150 / 4e-43 AT3G47570 786 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.010G228200 [exp] 149 / 6e-43 AT3G47570 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.010G228300 [exp] 148 / 2e-42 AT3G47570 743 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G152500 [exp] 147 / 2e-42 AT3G47570 753 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.006G099100 [exp] 147 / 3e-42 AT3G47570 787 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G151400 [exp] 147 / 3e-42 AT3G47570 763 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10028479 pacid=23165974 polypeptide=Lus10028479 locus=Lus10028479.g ID=Lus10028479.BGIv1.0 annot-version=v1.0 ATGGCGGAATGTAAAGTATTGAAAAACATTAGGCACAAAAATCTTGTGAGGATAGTAACAGTATACTTAAGTGTTGATCATGAAGGGAATGATTTCAAGG CTCTCATCTATGACTTCTTAGTTAGTGAAAGCTTAGAAGACTGGCTTCATCGGCCAATTGAAACTATAGATGAGTCGACAACAAAAAGCTTGAATTTCAC CCAAAGGCTACATGTTGCTATTGAGATAGCTTTCAGAGTGGATTATCTTTACAACAATTGTGGAACGCCAATTGTTCATTGTGATCTCAAGCTTAGCAAT GTACTTCTTGACAAGGATATAATTGCTCATGTTGGTGATTTTGGATTGGCACGATTCCTTTAA
AA sequence Show only first row Show all	>Lus10028479 pacid=23165974 polypeptide=Lus10028479 locus=Lus10028479.g ID=Lus10028479.BGIv1.0 annot-version=v1.0 MAECKVLKNIRHKNLVRIVTVYLSVDHEGNDFKALIYDFLVSESLEDWLHRPIETIDESTTKSLNFTQRLHVAIEIAFRVDYLYNNCGTPIVHCDLKLSN VLLDKDIIAHVGDFGLARFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G47090			Leucine-rich repeat protein ki...		Lus10028479 [exp]	0	1
AT2G22180			hydroxyproline-rich glycoprote...		Lus10000688 [exp]	2.2	1.0000
					Lus10000824 [exp]	3.2	1.0000
AT2G33470		ATGLTP1, GLTP1	ARABIDOPSIS GLYCOLIPID TRANSFE...		Lus10003626 [exp]	4.5	1.0000
					Lus10003272 [exp]	5.5	1.0000
					Lus10011629 [exp]	5.5	1.0000
AT5G26150			protein kinase family protein ...		Lus10024998 [exp]	6.7	1.0000
					Lus10010826 [exp]	7.1	1.0000
AT1G11040			HSP40/DnaJ peptide-binding pro...		Lus10025682 [exp]	7.1	1.0000
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10031808 [exp]	7.2	0.9257
					Lus10029832 [exp]	7.4	1.0000

Compare expression of checked genes

Lus10028479 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.