Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66880 73 / 1e-16 Protein kinase superfamily protein (.1) AT5G38210 72 / 2e-16 Protein kinase family protein (.1) AT1G25390 51 / 6e-09 Protein kinase superfamily protein (.1) AT1G18390 45 / 9e-07 Protein kinase superfamily protein (.1.2) AT5G66790 44 / 2e-06 Protein kinase superfamily protein (.1) AT2G23450 42 / 8e-06 Protein kinase superfamily protein (.1.2) AT2G28930 41 / 2e-05 APK1B protein kinase 1B (.1.2.3) AT1G69910 40 / 3e-05 Protein kinase superfamily protein (.1) AT2G17220 37 / 0.0005 Kin3 kinase 3, Protein kinase superfamily protein (.1.2) AT4G21230 36 / 0.001 CRK27 cysteine-rich RLK (RECEPTOR-like protein kinase) 27 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009149 [exp] 159 / 7e-53 AT1G66880 78 / 2e-18 Protein kinase superfamily protein (.1) Lus10029132 [exp] 56 / 1e-10 AT1G18390 537 / 0.0 Protein kinase superfamily protein (.1.2) Lus10016737 [exp] 51 / 1e-08 AT1G18390 544 / 0.0 Protein kinase superfamily protein (.1.2) Lus10022432 [exp] 49 / 3e-08 AT1G18390 543 / 0.0 Protein kinase superfamily protein (.1.2) Lus10011652 [exp] 43 / 6e-06 AT2G23450 337 / 2e-111 Protein kinase superfamily protein (.1.2) Lus10004964 [exp] 40 / 5e-05 AT2G28930 570 / 0.0 protein kinase 1B (.1.2.3) Lus10032741 [exp] 40 / 7e-05 AT2G23450 578 / 0.0 Protein kinase superfamily protein (.1.2) Lus10005462 [exp] 40 / 7e-05 AT2G28930 569 / 0.0 protein kinase 1B (.1.2.3) Lus10000741 [exp] 39 / 9e-05 AT2G23450 697 / 0.0 Protein kinase superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G096550 [exp] 94 / 4e-24 AT5G38210 594 / 0.0 Protein kinase family protein (.1) Potri.017G118100 [exp] 93 / 8e-24 AT5G38210 575 / 0.0 Protein kinase family protein (.1) Potri.004G096900 [exp] 92 / 3e-23 AT5G38210 557 / 0.0 Protein kinase family protein (.1) Potri.017G118250 [exp] 90 / 9e-23 AT5G38210 542 / 0.0 Protein kinase family protein (.1) Potri.012G054725 [exp] 62 / 8e-13 AT1G18390 516 / 2e-176 Protein kinase superfamily protein (.1.2) Potri.015G044750 [exp] 59 / 8e-12 AT1G18390 532 / 0.0 Protein kinase superfamily protein (.1.2) Potri.004G097100 [exp] 58 / 2e-11 AT5G38210 525 / 4e-179 Protein kinase family protein (.1) Potri.015G045101 [exp] 54 / 4e-10 AT1G18390 659 / 0.0 Protein kinase superfamily protein (.1.2) Potri.010G121100 [exp] 52 / 4e-09 AT1G25390 524 / 1e-179 Protein kinase superfamily protein (.1) Potri.007G034500 [exp] 47 / 1e-07 AT2G23450 731 / 0.0 Protein kinase superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028495 pacid=23166039 polypeptide=Lus10028495 locus=Lus10028495.g ID=Lus10028495.BGIv1.0 annot-version=v1.0 ATGGTGACGTCGGTGGCTGAGCTGGCGTTCAGGTGTCTGCAGCAGGAGAGGGACATGAGGCCTACTATGAACGAGGTTGTCGGGATGCTGAAGAGGATTG AGAAGGAGAATGAATTGGGGGAGTTCCAGAAGGCTGAGGTTGTTGATATTGCTAAAGACGATGTTGGTTTGCTGCAGAATTTTTCTCCTCCCGTGCTTTC CCCCGACTCTGGAGCCAATGACAAATGGAATAAGGTGATGAGGACGATGTGA
AA sequence Show only first row Show all	>Lus10028495 pacid=23166039 polypeptide=Lus10028495 locus=Lus10028495.g ID=Lus10028495.BGIv1.0 annot-version=v1.0 MVTSVAELAFRCLQQERDMRPTMNEVVGMLKRIEKENELGEFQKAEVVDIAKDDVGLLQNFSPPVLSPDSGANDKWNKVMRTM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G38210			Protein kinase family protein ...		Lus10028495 [exp]	0	1
AT1G66880			Protein kinase superfamily pro...		Lus10028494 [exp]	1.0	0.9900
AT5G06860		ATPGIP1, PGIP1	polygalacturonase inhibiting p...		Lus10021028 [exp]	2.8	0.9779
AT3G23250	MYB	ATMYB15, ATY19	myb domain protein 15 (.1.2)		Lus10033889 [exp]	3.0	0.9814
AT4G23690			Disease resistance-responsive ...		Lus10032331 [exp]	3.9	0.9791
AT4G06536			SPla/RYanodine receptor (SPRY)...		Lus10018730 [exp]	4.9	0.9826
					Lus10031841 [exp]	5.9	0.9783
AT3G59710			NAD(P)-binding Rossmann-fold s...		Lus10035736 [exp]	6.9	0.9793
AT2G35980		NHL10, YLS9, AT...	YELLOW-LEAF-SPECIFIC GENE 9, A...		Lus10021288 [exp]	7.3	0.9787
AT1G15170			MATE efflux family protein (.1...		Lus10028540 [exp]	8.9	0.9744
AT5G53850			haloacid dehalogenase-like hyd...		Lus10009198 [exp]	10.3	0.9591

Compare expression of checked genes

Lus10028495 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.