Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64130 143 / 1e-45 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) AT1G69510 107 / 6e-31 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) AT4G16146 69 / 2e-16 cAMP-regulated phosphoprotein 19-related protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009146 [exp] 196 / 1e-66 AT5G64130 150 / 2e-48 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10036768 [exp] 101 / 8e-29 AT5G64130 116 / 6e-35 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10030448 [exp] 97 / 1e-26 AT1G69510 123 / 1e-36 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10026615 [exp] 97 / 1e-26 AT1G69510 123 / 1e-36 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10037162 [exp] 100 / 1e-25 AT1G69523 268 / 4e-84 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10037727 [exp] 63 / 9e-13 AT5G49350 136 / 1e-38 Glycine-rich protein family (.1.2) Lus10016857 [exp] 61 / 4e-12 AT5G49350 138 / 3e-40 Glycine-rich protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G111900 [exp] 166 / 1e-54 AT5G64130 152 / 4e-49 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Potri.017G102700 [exp] 159 / 4e-52 AT5G64130 159 / 1e-51 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Potri.010G167000 [exp] 106 / 3e-30 AT1G69510 104 / 4e-29 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Potri.008G108201 [exp] 74 / 4e-18 AT4G16146 103 / 4e-30 cAMP-regulated phosphoprotein 19-related protein (.1) Potri.010G141300 [exp] 73 / 4e-18 AT4G16146 105 / 3e-31 cAMP-regulated phosphoprotein 19-related protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04667 [flax] [poplar] Endosulfine cAMP-regulated phosphoprotein/endosulfine conserved region
Representative CDS sequence Show only first row Show all	>Lus10028499 pacid=23166041 polypeptide=Lus10028499 locus=Lus10028499.g ID=Lus10028499.BGIv1.0 annot-version=v1.0 ATGGATGATACCGAGGATAAAAACTCTGCACCACCTTCTAAAGAAGAGGAAGAAGCTATGAAGAAAAAATATGGTGGCCTCATGCCTAAGAAACCGCCAC TCATTTCCAAGGATCATGAACGTGCATACTTTGATTCTGCTGATTGGGCACTTGGAAAGGTTGATTTCCAATTAGTTCATCAAGGTGTTGAGAAGCCTAA GGGACCGCTTGAAGCTCTTCGCCCCAAATTACAGCCGACACAGCAGCAGACACGGTACCGAAAGTCTCCATATGCTCCATCAGATGGTGAAGGTGTAGGA GGTAGCACATCTGAGGATGCAGCTCCAAACAAATGA
AA sequence Show only first row Show all	>Lus10028499 pacid=23166041 polypeptide=Lus10028499 locus=Lus10028499.g ID=Lus10028499.BGIv1.0 annot-version=v1.0 MDDTEDKNSAPPSKEEEEAMKKKYGGLMPKKPPLISKDHERAYFDSADWALGKVDFQLVHQGVEKPKGPLEALRPKLQPTQQQTRYRKSPYAPSDGEGVG GSTSEDAAPNK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G64130			cAMP-regulated phosphoprotein ...		Lus10028499 [exp]	0	1
AT5G08370		ATAGAL2	alpha-galactosidase 2 (.1.2)		Lus10036176 [exp]	6.5	0.7291
					Lus10043166 [exp]	7.1	0.7072
AT2G36660		PAB7	poly(A) binding protein 7 (.1)		Lus10014392 [exp]	21.7	0.6597
AT5G64130			cAMP-regulated phosphoprotein ...		Lus10009146 [exp]	21.9	0.6513
AT1G28340		AtRLP4	receptor like protein 4 (.1)		Lus10015320 [exp]	24.5	0.6591
AT3G15130			Tetratricopeptide repeat (TPR)...		Lus10007682 [exp]	25.0	0.6327
AT3G15095		HCF243	high chlorophyll fluorescence ...		Lus10013679 [exp]	33.0	0.6274
AT4G39210		APL3	Glucose-1-phosphate adenylyltr...		Lus10040437 [exp]	40.8	0.6532
AT5G10140	MADS	FLF, AGL25, FLC	FLOWERING LOCUS F, FLOWERING L...		Lus10003123 [exp]	43.6	0.6389
AT4G28250		ATHEXPBETA1.6, ...	expansin B3 (.1.2)		Lus10039816 [exp]	46.5	0.6328

Compare expression of checked genes

Lus10028499 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.