Lus10028506 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36810 110 / 1e-28 GGPS1 geranylgeranyl pyrophosphate synthase 1 (.1)
AT2G18620 109 / 2e-28 Terpenoid synthases superfamily protein (.1)
AT3G14530 102 / 1e-25 Terpenoid synthases superfamily protein (.1)
AT3G14510 100 / 1e-25 Polyprenyl synthetase family protein (.1)
AT2G23800 100 / 6e-25 GGPS5, GGPS2 GERANYLGERANYL PYROPHOSPHATE SYNTHASE 5, geranylgeranyl pyrophosphate synthase 2 (.1)
AT3G14550 98 / 3e-24 GGPS3 geranylgeranyl pyrophosphate synthase 3 (.1)
AT2G18640 96 / 2e-23 GGPS4 geranylgeranyl pyrophosphate synthase 4 (.1)
AT3G20160 95 / 6e-23 Terpenoid synthases superfamily protein (.1)
AT3G29430 94 / 8e-23 Terpenoid synthases superfamily protein (.1)
AT3G32040 90 / 4e-21 Terpenoid synthases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009136 165 / 3e-52 AT2G18620 177 / 1e-55 Terpenoid synthases superfamily protein (.1)
Lus10033582 167 / 7e-52 AT4G36810 305 / 6e-104 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028509 166 / 6e-50 AT4G36810 437 / 2e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028508 164 / 4e-49 AT4G36810 380 / 9e-132 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10017624 165 / 9e-49 AT4G36810 439 / 5e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10017625 163 / 1e-48 AT4G36810 423 / 5e-148 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10009138 147 / 1e-42 AT4G36810 373 / 2e-128 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028507 147 / 2e-42 AT4G36810 375 / 2e-129 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10009137 109 / 2e-30 AT4G36810 131 / 2e-37 geranylgeranyl pyrophosphate synthase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G090600 142 / 7e-41 AT4G36810 419 / 1e-146 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124600 137 / 9e-39 AT4G36810 388 / 2e-134 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124700 128 / 2e-35 AT4G36810 413 / 1e-144 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.005G127100 115 / 2e-30 AT4G36810 444 / 2e-156 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.007G031100 111 / 4e-29 AT4G36810 467 / 1e-165 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.004G179628 78 / 8e-17 AT4G38460 403 / 3e-141 geranylgeranyl reductase (.1)
Potri.009G139600 77 / 1e-16 AT4G38460 389 / 7e-136 geranylgeranyl reductase (.1)
Potri.015G043400 57 / 2e-09 AT4G38460 121 / 4e-32 geranylgeranyl reductase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0613 Terp_synthase PF00348 polyprenyl_synt Polyprenyl synthetase
Representative CDS sequence
>Lus10028506 pacid=23166096 polypeptide=Lus10028506 locus=Lus10028506.g ID=Lus10028506.BGIv1.0 annot-version=v1.0
ATGGGACATCCTGATTTCAGGAACTCAGGAGTTGAGTTGCTATGTACAAATCAGCCTGAGAATGAATACATGATTTCCAAGATCAACCGAGTGGACAAGG
CTCTTGAAAATTCCATTCTCCTTCGCCACCCTCTCAAAATCCACGAGGCAATCCTCTACTCCCTCTTTGCCGGAGGGAAGTGGGTCCGTCCAGTCCTCTG
CATTGCCGCCTGCGAGATGTTCGGCGGTAATGAATCGCTTGCGATGCCAACGGCCTGCGCTGCAGAGATGGTCCACACCATGTCTCGCAAGGAAGTGAGT
TTGGAGGAATTGGAGTATATGCAAATCTACAAATCAACGAGGCTGGTGGAGACGGCGGTGGTGTGTGGTGTGATTATCAGTGGAGCGGATGATGAGAGTT
TGGAGAAGTTGAGGAACTATTCGAGGTGTGTGGGGTTACTGATCCAGGTTGTTGATGATATTCAGGGCGTTGCGAAGGATGTTGTTATCGATAAGGCAAC
GTATCTGAAACTCCTGGGATTGGATGGTGCCAGGAGATCCGCGTTCGAGTTGGTCGATGAAGCTAATAAGAAATTGAGTGATTTTGATCCTATCAAGGCC
GCACCTCTCTACCACTATGCTAATTATGTTGCTACTCTACAAGGCTAA
AA sequence
>Lus10028506 pacid=23166096 polypeptide=Lus10028506 locus=Lus10028506.g ID=Lus10028506.BGIv1.0 annot-version=v1.0
MGHPDFRNSGVELLCTNQPENEYMISKINRVDKALENSILLRHPLKIHEAILYSLFAGGKWVRPVLCIAACEMFGGNESLAMPTACAAEMVHTMSRKEVS
LEELEYMQIYKSTRLVETAVVCGVIISGADDESLEKLRNYSRCVGLLIQVVDDIQGVAKDVVIDKATYLKLLGLDGARRSAFELVDEANKKLSDFDPIKA
APLYHYANYVATLQG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10028506 0 1
AT5G04347 Plant self-incompatibility pro... Lus10029375 6.6 0.6137
AT5G48540 receptor-like protein kinase-r... Lus10030777 9.4 0.6137
AT5G52605 Defensin-like (DEFL) family pr... Lus10031095 11.5 0.6137
AT1G21000 PLATZ transcription factor fam... Lus10005350 13.3 0.6137
Lus10012269 14.8 0.6137
AT3G26660 AS2 LBD24 LOB domain-containing protein ... Lus10023434 15.7 0.5473
Lus10035508 16.2 0.6137
Lus10021893 16.7 0.6135
AT5G56670 Ribosomal protein S30 family p... Lus10019054 17.5 0.6137
AT3G18040 ATMPK9 MAP kinase 9 (.1.2) Lus10038956 18.8 0.6137

Lus10028506 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.