Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66400 117 / 2e-34 CML23 calmodulin like 23 (.1) AT5G37770 108 / 2e-31 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT1G18210 107 / 1e-30 Calcium-binding EF-hand family protein (.1.2) AT1G24620 98 / 6e-27 EF hand calcium-binding protein family (.1) AT1G73630 96 / 3e-26 EF hand calcium-binding protein family (.1) AT5G17470 92 / 1e-24 EF hand calcium-binding protein family (.1) AT2G36180 82 / 6e-21 EF hand calcium-binding protein family (.1) AT2G15680 82 / 1e-20 AtCML30 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) AT5G21274 76 / 1e-18 ACAM-6, CAM6 calmodulin 6 (.1) AT1G66410 76 / 1e-18 ACAM-4, CAM4 calmodulin 4 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009127 [exp] 204 / 3e-67 AT1G66400 147 / 2e-44 calmodulin like 23 (.1) Lus10018012 [exp] 101 / 5e-28 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10009059 [exp] 99 / 3e-27 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2) Lus10004330 [exp] 98 / 5e-27 AT1G24620 207 / 2e-69 EF hand calcium-binding protein family (.1) Lus10027081 [exp] 97 / 9e-27 AT1G18210 131 / 2e-39 Calcium-binding EF-hand family protein (.1.2) Lus10028913 [exp] 97 / 1e-26 AT1G24620 204 / 5e-68 EF hand calcium-binding protein family (.1) Lus10031345 [exp] 96 / 4e-26 AT1G18210 196 / 1e-64 Calcium-binding EF-hand family protein (.1.2) Lus10024574 [exp] 90 / 5e-24 AT1G24620 143 / 4e-44 EF hand calcium-binding protein family (.1) Lus10039391 [exp] 78 / 3e-19 AT4G14640 268 / 1e-93 calmodulin-like 8, calmodulin 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G089400 [exp] 149 / 2e-47 AT1G66400 157 / 7e-50 calmodulin like 23 (.1) Potri.017G126200 [exp] 137 / 1e-42 AT1G66400 155 / 5e-49 calmodulin like 23 (.1) Potri.012G048200 [exp] 105 / 7e-30 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2) Potri.008G134300 [exp] 103 / 6e-29 AT1G24620 219 / 2e-73 EF hand calcium-binding protein family (.1) Potri.010G107100 [exp] 102 / 2e-28 AT1G24620 220 / 2e-73 EF hand calcium-binding protein family (.1) Potri.015G039500 [exp] 97 / 2e-26 AT1G18210 189 / 6e-62 Calcium-binding EF-hand family protein (.1.2) Potri.014G070700 [exp] 92 / 4e-24 AT1G18210 94 / 2e-24 Calcium-binding EF-hand family protein (.1.2) Potri.008G159300 [exp] 77 / 5e-19 AT3G22930 235 / 1e-80 calmodulin-like 11 (.1) Potri.018G127100 [exp] 78 / 9e-19 AT3G07490 132 / 6e-39 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.010G080900 [exp] 76 / 1e-18 AT4G14640 270 / 2e-94 calmodulin-like 8, calmodulin 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [flax] [poplar] EF_hand PF00036 [flax] [poplar] EF-hand_1 EF hand
Representative CDS sequence Show only first row Show all	>Lus10028516 pacid=23166068 polypeptide=Lus10028516 locus=Lus10028516.g ID=Lus10028516.BGIv1.0 annot-version=v1.0 ATGAAGGAGTTCGACAAGGACGGCGACGGCTACATTGACCTGGACGAGTTCGTCGGGTTCATCCAGAGCGGCGGATTCGACGACTCCGAGTCCGTCGACG GGAGTGGCCGCCGCGGAGGAGGAGCTGCAGGGAGGAAGGAACTGAAGGACGCTTTCGATCTGTACGACATGGACAAGAACGGGCTGATATCCGCTAACGA GCTGCACGCGGTGATGAAGATGCTGGGGCTGAAATGCAGCATGGGCGAGTGCAAGAAGATGATCCGGCAGGTGGACCAGGACGGCGACGGCAGTGTCAAC TTTGAGGAGTTCAGGAAGATGATGTCTACCAGCAACCGCGCTCCGGCAGCGTAA
AA sequence Show only first row Show all	>Lus10028516 pacid=23166068 polypeptide=Lus10028516 locus=Lus10028516.g ID=Lus10028516.BGIv1.0 annot-version=v1.0 MKEFDKDGDGYIDLDEFVGFIQSGGFDDSESVDGSGRRGGGAAGRKELKDAFDLYDMDKNGLISANELHAVMKMLGLKCSMGECKKMIRQVDQDGDGSVN FEEFRKMMSTSNRAPAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G66400		CML23	calmodulin like 23 (.1)		Lus10028516 [exp]	0	1
AT1G66400		CML23	calmodulin like 23 (.1)		Lus10009127 [exp]	1.7	0.9023
AT5G51570			SPFH/Band 7/PHB domain-contain...		Lus10015032 [exp]	1.7	0.9217
AT2G43290		MSS3	multicopy suppressors of snf4 ...		Lus10027701 [exp]	2.4	0.9142
					Lus10033310 [exp]	5.0	0.8957
AT2G22500		UCP5, ATPUMP5, ...	DICARBOXYLATE CARRIER 1, PLANT...		Lus10009270 [exp]	7.7	0.8977
AT2G27260			Late embryogenesis abundant (L...		Lus10005216 [exp]	8.1	0.8929
AT5G01710			methyltransferases (.1)		Lus10014232 [exp]	8.5	0.8861
AT5G67300	MYB	ATMYB44, AtMYBr...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10010260 [exp]	8.5	0.8862
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10015496 [exp]	9.9	0.8869
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Lus10034363 [exp]	10.8	0.8763

Compare expression of checked genes

Lus10028516 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.