Lus10028522 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10028522 pacid=23166119 polypeptide=Lus10028522 locus=Lus10028522.g ID=Lus10028522.BGIv1.0 annot-version=v1.0
ATGAAAATGGCACCACCACTACCATTTTCATTAACCCTTCTGATCATATCCTTTCTCCTCCTCCAAATCATCAACGCCGCTAATATTAATACAACCGTTA
TTACAGAAATAAAGCTGGATGATGACGGCGGCGAGATTAAGTGCGGCTCATGCCCTTGTGTCAACCCATGCACCCAGCTGGCGCCGCCTCCTCTGCCACC
GCCGCCACCACCTCCACCACCACCCTCTCCCCCACCGCCGCCATACTGCGCTCCTCTTATCCCGCCTCCGCCTCCTCCGCCGTCACCACCACCGCCGTGT
CCGCCGCCACCGAGGTTTGTGTACGTGGAATATAAACCACCCCCGCCCCCTCCCAAGTTTGTGTACCCGTACGATTGGAATTACTATAATCGTGGTCAAC
GCAGCGTCAAGATTGGTCATCATGCGGTAACTACTGTTATGGTCGTACTGGGTGCTGGATTCCTAGGCATCATCTAG
AA sequence
>Lus10028522 pacid=23166119 polypeptide=Lus10028522 locus=Lus10028522.g ID=Lus10028522.BGIv1.0 annot-version=v1.0
MKMAPPLPFSLTLLIISFLLLQIINAANINTTVITEIKLDDDGGEIKCGSCPCVNPCTQLAPPPLPPPPPPPPPPSPPPPPYCAPLIPPPPPPPSPPPPC
PPPPRFVYVEYKPPPPPPKFVYPYDWNYYNRGQRSVKIGHHAVTTVMVVLGAGFLGII

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10028522 0 1
AT3G24770 CLE41 CLAVATA3/ESR-RELATED 41 (.1) Lus10011868 2.4 0.9321
AT4G08150 HD BP1, KNAT1 BREVIPEDICELLUS 1, BREVIPEDICE... Lus10007245 4.2 0.8982
AT2G46630 unknown protein Lus10005994 5.3 0.9109
AT5G63710 Leucine-rich repeat protein ki... Lus10025703 6.3 0.9239
AT5G19040 ATIPT5 Arabidopsis thaliana ISOPENTEN... Lus10034025 6.3 0.9101
AT5G05280 RING/U-box superfamily protein... Lus10034228 7.0 0.9039
AT3G16330 unknown protein Lus10038274 7.7 0.9150
AT4G36710 GRAS AtHAM4 Arabidopsis thaliana HAIRY MER... Lus10041721 8.1 0.8914
AT4G01070 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYL... Lus10003944 8.5 0.8942
AT1G75390 bZIP ATBZIP44 basic leucine-zipper 44 (.1.2) Lus10001347 9.7 0.8537

Lus10028522 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.