Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03341 106 / 3e-32 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009121 [exp] 118 / 1e-36 AT3G03341 102 / 1e-30 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G128600 [exp] 112 / 2e-34 AT3G03341 113 / 9e-35 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028523 pacid=23166113 polypeptide=Lus10028523 locus=Lus10028523.g ID=Lus10028523.BGIv1.0 annot-version=v1.0 ATGGTGGGAGTCGGCGTACCGATTTGTATGCAATGTGGGACCCACAGCAATCCATGCCGGTGCAAGGTGGTGGGGCCGACGGTTGGGTTTCTGGCGTTTG CGGCGGCGGCAGTGGTGGAGTGGCCGGTGGGGGCGTTCGTGTACATCTTCAAGCATCGGAAAGGTAGGCGGATTATGGCCCATCCGGCCACCGTTGTTTA CCCTTCCGTCACCAATGCCATTCCAATCTGA
AA sequence Show only first row Show all	>Lus10028523 pacid=23166113 polypeptide=Lus10028523 locus=Lus10028523.g ID=Lus10028523.BGIv1.0 annot-version=v1.0 MVGVGVPICMQCGTHSNPCRCKVVGPTVGFLAFAAAAVVEWPVGAFVYIFKHRKGRRIMAHPATVVYPSVTNAIPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03341			unknown protein		Lus10028523 [exp]	0	1
AT1G75540	CO	LHUS, AtBBX21, ...	long hypocotyl under shade, B-...		Lus10028791 [exp]	4.5	0.8705
AT2G42610		LSH10	LIGHT SENSITIVE HYPOCOTYLS 10,...		Lus10020700 [exp]	5.2	0.8349
AT1G27040			Major facilitator superfamily ...		Lus10002793 [exp]	8.1	0.8373
AT4G37770		ACS8	1-amino-cyclopropane-1-carboxy...		Lus10011565 [exp]	9.8	0.8243
AT5G19340			unknown protein		Lus10010529 [exp]	11.5	0.8152
AT2G40330		RCAR9, PYL6	regulatory components of ABA r...		Lus10007275 [exp]	11.8	0.8217
AT2G22140		ATEME1B	essential meiotic endonuclease...		Lus10005803 [exp]	12.6	0.7455
AT4G17370			Oxidoreductase family protein ...		Lus10028967 [exp]	17.0	0.7499
AT2G33810	SBP	SPL3	squamosa promoter binding prot...		Lus10015421 [exp]	17.5	0.8192
					Lus10040690 [exp]	18.1	0.8151

Compare expression of checked genes

Lus10028523 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.