Lus10028524 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0392 Chaperone-J PF00226 DnaJ DnaJ domain
Representative CDS sequence
>Lus10028524 pacid=23165982 polypeptide=Lus10028524 locus=Lus10028524.g ID=Lus10028524.BGIv1.0 annot-version=v1.0
ATGGGAGAAGCATTCTTGGATTACGCAAAGGAGCTTTACCGAAACGGAAAGGTGAACGAAGCCTACAACATGGCACTCCTAGTCTCCCGCAACGACGCCT
TCTGTCCAAACGTCCACCAGTTGGTCGCCATCTACGGCGTCCTCATCCACCGCCGCAGCGCCGTCAACAGAAGTCGCATCGACTGCTACAGAGTCCTCGG
AGTCCCCTCCTCCGCCTCCGACGAACAAATCGCCCACCGATTCGCTACTCTCAAGAAAATCATCGCCCCCGCCCGCAATACCTCCCCGTCCGCCTCCCGG
AGCAGTACTGCCGCCGCTGCCGAGGCTGCTAATTCCCTCCTCAATTTCGCCTTCGAGACTTTGTCGGATGAGAGATCCAGACGGGAGTTTGATTCTCGCC
GGAAGTTGTCGCAATTGAAGAAGCCTACTGATCAGAATGCCGGCAAGGAGAAGAAGGAGTCGCTGATTCTCCCTCCCCCGCCGCCACAATGGAAGGAGGC
TCCGGTGAGAAGGATCCGAGTGGTGTACGGCACGAAGAAGAGCTATCGATGTGATCCTATCGGTTCAAGTTTAAGCGGCCACCATCGAAGGCGGATGCAG
AGTGGGATGTGA
AA sequence
>Lus10028524 pacid=23165982 polypeptide=Lus10028524 locus=Lus10028524.g ID=Lus10028524.BGIv1.0 annot-version=v1.0
MGEAFLDYAKELYRNGKVNEAYNMALLVSRNDAFCPNVHQLVAIYGVLIHRRSAVNRSRIDCYRVLGVPSSASDEQIAHRFATLKKIIAPARNTSPSASR
SSTAAAAEAANSLLNFAFETLSDERSRREFDSRRKLSQLKKPTDQNAGKEKKESLILPPPPPQWKEAPVRRIRVVYGTKKSYRCDPIGSSLSGHHRRRMQ
SGM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G19570 Chaperone DnaJ-domain superfam... Lus10028524 0 1
AT4G14746 unknown protein Lus10025761 7.3 0.6172
AT3G14470 NB-ARC domain-containing disea... Lus10032781 10.8 0.6232
AT5G59310 LTP4 lipid transfer protein 4 (.1) Lus10028002 11.0 0.6081
AT1G52190 Major facilitator superfamily ... Lus10009505 17.5 0.5516
AT3G19940 Major facilitator superfamily ... Lus10040991 23.0 0.6029
AT1G14185 Glucose-methanol-choline (GMC)... Lus10030458 23.1 0.5363
AT5G67360 ARA12 Subtilase family protein (.1) Lus10027896 25.0 0.5430
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10028883 26.3 0.5563
AT1G15170 MATE efflux family protein (.1... Lus10004899 43.0 0.5349
AT4G02340 alpha/beta-Hydrolases superfam... Lus10004439 51.5 0.5025

Lus10028524 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.