Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17450 194 / 1e-64 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT1G71050 174 / 1e-56 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 160 / 2e-51 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT5G66110 133 / 1e-40 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT4G39700 133 / 2e-40 Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 130 / 3e-39 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT4G08570 118 / 1e-34 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 117 / 3e-34 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 97 / 6e-26 Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 95 / 3e-25 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009115 [exp] 283 / 1e-99 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016708 [exp] 187 / 9e-62 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 187 / 1e-61 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 184 / 1e-60 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10032446 [exp] 176 / 6e-57 AT1G71050 175 / 2e-56 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 157 / 1e-49 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 157 / 1e-49 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 156 / 1e-49 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10028426 [exp] 140 / 3e-43 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G123400 [exp] 239 / 2e-82 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.010G114600 [exp] 201 / 3e-67 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 159 / 1e-50 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 155 / 2e-49 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G110400 [exp] 149 / 1e-46 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) Potri.004G175400 [exp] 144 / 6e-45 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.009G135300 [exp] 137 / 6e-42 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G167000 [exp] 135 / 3e-41 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 131 / 1e-39 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 126 / 9e-38 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10028531 pacid=23166012 polypeptide=Lus10028531 locus=Lus10028531.g ID=Lus10028531.BGIv1.0 annot-version=v1.0 ATGGGAGCTCTTGATCTCATATCAAACTTTTGCAGCGAGACCAGCACCGCCACAAGTACTCGAAGATCCAAGCGCAGACCAATGCAGACGGTGGAGATAA AGGTGAAAATGGACTGCGACGGGTGCGAAAGGAGAGTGAAAAATGCTGTTTCCACCATGAAAGGAGTGAAGACGGTGGAAGTAATAAGGAAACAGAACAG GGTAGTGGTGAGCGGGTACGTGGAGCCCAACCGGGTGCTGAAGCGGGTGAAGAGCACCGGCAAGGTGGCGGAGTTCTGGCCGTACGTACCGCAGCATCTC GCATACTACCCTTACGCCGCCGGAGTTTACGACAAGAAGGCTCCCGCCGGCTTTGTCCGCAACGTCGTCCAGGCTTTCCCTAGTAACAACAACAGTCATG TCCCCGAAGAGAACTTTGTCTCCTTCTTTAGCGACGACAACGTCAATGCTTGCTCCATCATGTGA
AA sequence Show only first row Show all	>Lus10028531 pacid=23166012 polypeptide=Lus10028531 locus=Lus10028531.g ID=Lus10028531.BGIv1.0 annot-version=v1.0 MGALDLISNFCSETSTATSTRRSKRRPMQTVEIKVKMDCDGCERRVKNAVSTMKGVKTVEVIRKQNRVVVSGYVEPNRVLKRVKSTGKVAEFWPYVPQHL AYYPYAAGVYDKKAPAGFVRNVVQAFPSNNNSHVPEENFVSFFSDDNVNACSIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17450		HIPP21	heavy metal associated isopren...		Lus10028531 [exp]	0	1
AT3G17810		PYD1	pyrimidine 1 (.1)		Lus10017995 [exp]	3.5	0.9446
AT2G32150			Haloacid dehalogenase-like hyd...		Lus10004914 [exp]	4.2	0.9421
AT2G14095			unknown protein		Lus10025500 [exp]	6.7	0.9290
AT3G57520		RS2, ATSIP2	raffinose synthase 2, seed imb...		Lus10007537 [exp]	8.5	0.9258
AT5G08130	bHLH	BIM1, bHLH046	basic helix-loop-helix (bHLH) ...		Lus10007974 [exp]	9.0	0.9088
					Lus10011059 [exp]	14.1	0.9125
AT4G20260		ATPCAP1	ARABIDOPSIS THALIANA PLASMA-ME...		Lus10036243 [exp]	19.1	0.9167
AT1G67910			unknown protein		Lus10023632 [exp]	20.0	0.9243
AT1G13245		RTFL17, DVL4	DEVIL 4, ROTUNDIFOLIA like 17 ...		Lus10041491 [exp]	25.7	0.9047
AT4G29820		CFIM-25, ATCFIM...	ARABIDOPSIS THALIANA HOMOLOG O...		Lus10027624 [exp]	27.7	0.9120

Compare expression of checked genes

Lus10028531 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.