Lus10028535 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G37930 134 / 7e-38 Protein with RING/U-box and TRAF-like domains (.1)
AT5G37870 122 / 1e-33 Protein with RING/U-box and TRAF-like domains (.1)
AT1G66620 111 / 2e-29 Protein with RING/U-box and TRAF-like domains (.1)
AT5G37890 107 / 3e-28 Protein with RING/U-box and TRAF-like domains (.1)
AT5G37910 102 / 4e-26 Protein with RING/U-box and TRAF-like domains (.1)
AT1G66650 100 / 5e-25 Protein with RING/U-box and TRAF-like domains (.1)
AT5G62800 94 / 8e-23 Protein with RING/U-box and TRAF-like domains (.1)
AT1G66630 89 / 7e-21 Protein with RING/U-box and TRAF-like domains (.1)
AT5G37900 87 / 1e-20 TRAF-like superfamily protein (.1)
AT1G66610 77 / 1e-16 TRAF-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009111 442 / 2e-160 AT5G37930 134 / 5e-38 Protein with RING/U-box and TRAF-like domains (.1)
Lus10013739 69 / 1e-13 AT3G58040 493 / 6e-178 seven in absentia of Arabidopsis 2 (.1)
Lus10039202 69 / 1e-13 AT3G58040 488 / 1e-175 seven in absentia of Arabidopsis 2 (.1)
Lus10018110 57 / 2e-09 AT4G27880 553 / 0.0 Protein with RING/U-box and TRAF-like domains (.1)
Lus10022405 57 / 2e-09 AT4G27880 553 / 0.0 Protein with RING/U-box and TRAF-like domains (.1)
Lus10016348 57 / 3e-09 AT3G61790 459 / 7e-163 Protein with RING/U-box and TRAF-like domains (.1)
Lus10002761 56 / 3e-09 AT3G61790 462 / 1e-164 Protein with RING/U-box and TRAF-like domains (.1)
Lus10030248 56 / 4e-09 AT3G61790 514 / 0.0 Protein with RING/U-box and TRAF-like domains (.1)
Lus10004001 56 / 4e-09 AT3G61790 525 / 0.0 Protein with RING/U-box and TRAF-like domains (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G148100 248 / 4e-81 AT5G37930 206 / 4e-63 Protein with RING/U-box and TRAF-like domains (.1)
Potri.004G072800 225 / 1e-72 AT5G37930 173 / 9e-51 Protein with RING/U-box and TRAF-like domains (.1)
Potri.004G091900 210 / 6e-69 AT5G37930 143 / 3e-41 Protein with RING/U-box and TRAF-like domains (.1)
Potri.017G122800 179 / 2e-54 AT5G37930 180 / 5e-53 Protein with RING/U-box and TRAF-like domains (.1)
Potri.004G091800 135 / 2e-36 AT5G37930 81 / 4e-16 Protein with RING/U-box and TRAF-like domains (.1)
Potri.001G010500 61 / 6e-11 AT3G58040 455 / 3e-163 seven in absentia of Arabidopsis 2 (.1)
Potri.003G215400 60 / 1e-10 AT3G58040 471 / 4e-169 seven in absentia of Arabidopsis 2 (.1)
Potri.006G194100 59 / 2e-10 AT3G58040 560 / 0.0 seven in absentia of Arabidopsis 2 (.1)
Potri.016G059700 59 / 3e-10 AT3G58040 548 / 0.0 seven in absentia of Arabidopsis 2 (.1)
Potri.002G171500 58 / 7e-10 AT3G61790 558 / 0.0 Protein with RING/U-box and TRAF-like domains (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0389 TRAF PF03145 Sina Seven in absentia protein family
Representative CDS sequence
>Lus10028535 pacid=23165972 polypeptide=Lus10028535 locus=Lus10028535.g ID=Lus10028535.BGIv1.0 annot-version=v1.0
ATGGCATACAAGTGCCCTTCATGTTGCTTGCCAATTGGCTACAATCGGTGTCGGGCAATCGAGAAGGTTCTAGAATCAGCCACCGTACGATGCTCAAATG
CATCCAACGGCTGCAAAGAGATAATCACCTACAGCAAAAAACAAGCACACGACAAGGACTGCATCTATGCACCGTGTCAGTGTCCAATCTCCGGCTGCAA
CTTCTCAGGCTCCGCCCAGCAGCTCTGCCACCATTTCACCTCCAACCACAAGAACCGCGCGGTACAGTTCCGGTACAACACCACCTTCCCAGCGTTCTTC
ACCAGCGACCACAAGTTCCTCATTCTTCAGGAGGAGAAAGAAGAGGTTCTCTTCTTTCTGACCAACAGTGAAGAAGTAATCGGGAACATGATCTACGTTA
GCTGTATAGGCCCCTCGTCGTACAAAGGGAAATTCTTCTACGAAGTGAGCGCGAAAACCGAGGACAGCAACCTTAAGTTTCAGGCCTTTACGGAGAACGT
TCTGAAGAAGGGGAATGCCCCGCCTCCAGGTGGGTTCCTTGTAGTTCCGGCTAGCTACTTTGGCAGGTACAAGCAAGTCAGTCTAGATGTCTGCATATAT
CAGGTCGAAACTTATCCTAGCGACTTTGTCCGTGCCACTGCAGCTTGA
AA sequence
>Lus10028535 pacid=23165972 polypeptide=Lus10028535 locus=Lus10028535.g ID=Lus10028535.BGIv1.0 annot-version=v1.0
MAYKCPSCCLPIGYNRCRAIEKVLESATVRCSNASNGCKEIITYSKKQAHDKDCIYAPCQCPISGCNFSGSAQQLCHHFTSNHKNRAVQFRYNTTFPAFF
TSDHKFLILQEEKEEVLFFLTNSEEVIGNMIYVSCIGPSSYKGKFFYEVSAKTEDSNLKFQAFTENVLKKGNAPPPGGFLVVPASYFGRYKQVSLDVCIY
QVETYPSDFVRATAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G37930 Protein with RING/U-box and TR... Lus10028535 0 1
AT5G67320 HOS15 high expression of osmotically... Lus10024972 3.7 0.8151
AT1G61730 GeBP DNA-binding storekeeper protei... Lus10010076 6.9 0.8250
AT5G27650 Tudor/PWWP/MBT superfamily pro... Lus10015177 7.7 0.7811
AT4G17060 FIP2 FRIGIDA interacting protein 2 ... Lus10001004 9.3 0.8005
AT1G14450 NADH dehydrogenase (ubiquinone... Lus10038124 12.0 0.7787
AT2G28310 Protein of unknown function (D... Lus10000145 17.0 0.7025
AT5G53300 UBC10 ubiquitin-conjugating enzyme 1... Lus10032352 17.3 0.7858
Lus10031351 17.7 0.7760
AT5G43490 unknown protein Lus10003153 18.4 0.7542
AT2G48010 RKF3 receptor-like kinase in in flo... Lus10029624 18.7 0.7599

Lus10028535 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.