Lus10028536 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G45220 322 / 8e-109 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G60730 319 / 9e-108 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT1G23200 311 / 3e-104 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT4G02330 305 / 2e-101 AtPME41, ATPMEPCRB pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G53370 301 / 5e-100 ATPMEPCRF pectin methylesterase PCR fragment F (.1)
AT3G49220 295 / 3e-97 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT1G02810 294 / 4e-97 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT4G02320 291 / 7e-97 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT2G47550 290 / 1e-95 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G14310 288 / 1e-94 ATPME3 pectin methylesterase 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009110 442 / 3e-156 AT1G23200 501 / 1e-173 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10038917 331 / 5e-112 AT2G45220 630 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10027202 327 / 4e-110 AT2G45220 620 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10006103 323 / 5e-110 AT2G45220 592 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10008203 312 / 1e-104 AT4G02320 497 / 2e-172 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10018103 306 / 3e-101 AT3G49220 799 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10031470 301 / 5e-100 AT4G02330 573 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10027206 299 / 5e-100 AT2G45220 551 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10015877 296 / 4e-99 AT3G60730 535 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G109400 368 / 8e-127 AT1G23200 579 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.015G127700 338 / 5e-115 AT2G45220 680 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.012G126800 338 / 5e-115 AT2G45220 637 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.015G127500 320 / 3e-108 AT2G45220 573 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.014G067100 318 / 2e-107 AT2G45220 691 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.002G145500 318 / 2e-107 AT2G45220 670 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.002G202500 307 / 1e-102 AT4G02320 576 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.014G127000 300 / 8e-100 AT1G02810 712 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.005G022800 300 / 2e-99 AT4G02330 571 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.003G072800 298 / 7e-99 AT3G14310 795 / 0.0 pectin methylesterase 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF01095 Pectinesterase Pectinesterase
Representative CDS sequence
>Lus10028536 pacid=23166114 polypeptide=Lus10028536 locus=Lus10028536.g ID=Lus10028536.BGIv1.0 annot-version=v1.0
ATGACATTCGAGAACACCGCCGGACCACAGAACCACCAAGCGGTTGCGCTCCGGTCGAGTTCGGACCTATCAGTGTTTTACAGGTGTAGCTTCAAGGGCT
ACCAAGACACTTTATACGTCCACTCCCAACGCCAGTTCTACCGCGACTGCGACATTTACGGCACTGTTGACTTCATCTTCGGCGACGCCTCGGTCGTGCT
TCAGAGCTGCAACATATACGTCAGAAGACCCATGAGTCACCAGAAGAACACCGTCACTGCTCAGGGAAGGACCGACCCCAACGAGAACACTGGCATCGTC
ATTCAAAGTTCCAGGATCATGGCAGCTGCAGACCTGGAACAAGTGCAGGGGTCCTTCGAGACATATCTAGGGAGGCCATGGAAGCAGTACTCGAGGACAC
TGGTGATAAAGAGCGCTATGGATGGATTTGTTGATCCCGCCGGATGGTTGCCGTGGAACGGAGAGTTTGCTCTGAGGACACTTTACTATGGAGAGTACAC
GAATAGTGGGATCGGAGGAAGGACTCAGGGCAGAGTTTCCTGGCCTGGGTTTCACGTGATTAGAAGCGCTACTGAGGCCGGAAAGTTCACCGTCGGGAAT
TTCCTGAACGGTGATGCTTGGATTCCGAGTAGTGGAGTGCCGTATGCCTCCGGTTTGTAA
AA sequence
>Lus10028536 pacid=23166114 polypeptide=Lus10028536 locus=Lus10028536.g ID=Lus10028536.BGIv1.0 annot-version=v1.0
MTFENTAGPQNHQAVALRSSSDLSVFYRCSFKGYQDTLYVHSQRQFYRDCDIYGTVDFIFGDASVVLQSCNIYVRRPMSHQKNTVTAQGRTDPNENTGIV
IQSSRIMAAADLEQVQGSFETYLGRPWKQYSRTLVIKSAMDGFVDPAGWLPWNGEFALRTLYYGEYTNSGIGGRTQGRVSWPGFHVIRSATEAGKFTVGN
FLNGDAWIPSSGVPYASGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G60730 Plant invertase/pectin methyle... Lus10028536 0 1
AT5G61890 AP2_ERF Integrase-type DNA-binding sup... Lus10006796 8.0 0.6709
AT1G47530 MATE efflux family protein (.1... Lus10016296 10.4 0.7910
AT1G07430 HAI2 highly ABA-induced PP2C gene 2... Lus10040738 15.5 0.6835
AT2G45750 S-adenosyl-L-methionine-depend... Lus10027432 18.1 0.6417
AT1G08790 Protein of unknown function (D... Lus10006560 19.8 0.7428
AT5G66430 S-adenosyl-L-methionine-depend... Lus10036547 32.9 0.6803
AT1G06520 ATGPAT1, GPAT1 glycerol-3-phosphate acyltrans... Lus10000071 37.7 0.6555
AT4G02340 alpha/beta-Hydrolases superfam... Lus10026138 38.4 0.6771
AT2G30900 TBL43 TRICHOME BIREFRINGENCE-LIKE 43... Lus10020786 40.9 0.6773
AT3G01570 Oleosin family protein (.1) Lus10028035 46.6 0.5198

Lus10028536 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.