Lus10028537 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49910 203 / 3e-68 Translation protein SH3-like family protein (.1)
AT5G67510 198 / 2e-66 Translation protein SH3-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018139 226 / 2e-77 AT3G49910 262 / 1e-91 Translation protein SH3-like family protein (.1)
Lus10019283 169 / 4e-55 AT3G49910 212 / 1e-72 Translation protein SH3-like family protein (.1)
Lus10011540 130 / 2e-40 AT3G49910 178 / 3e-59 Translation protein SH3-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G085200 211 / 1e-71 AT3G49910 241 / 3e-83 Translation protein SH3-like family protein (.1)
Potri.007G055900 208 / 2e-70 AT3G49910 236 / 2e-81 Translation protein SH3-like family protein (.1)
Potri.005G082600 184 / 1e-60 AT3G49910 214 / 2e-72 Translation protein SH3-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF00467 KOW KOW motif
Representative CDS sequence
>Lus10028537 pacid=23164627 polypeptide=Lus10028537 locus=Lus10028537.g ID=Lus10028537.BGIv1.0 annot-version=v1.0
ATGAAGTACAATCCTAGGGTTTCCTCCTCCCGCCGCAAGAACCGCAAGGCGCACTTCACGGCGCCGTCGTCGGTCCGCCGCGTTCTGATGAGCGCACCGC
TCTCCACCGACCTCCGCCAGAAGTACAACGTCAGGTCGATGCCGGTTCGCAAGGATGACGAGGTCCAGGTCGTCAGGGGAACCTTCAAGGGTCGCGAGGG
CAAAGTGGTGCAGGTGTACCGCCGGAAGTGGGTCATCCACATCGAGCGCATCACAAGGGAGAAGGTGAACGGATCCACCGTCAACGTCGGAGTCCACCCT
TCGAAGGTCGTCGTCACCAAGCTCCGCCTCGACAAGGATCGCAAGTCTCTGCTCGACCGCAAGGCCAAAGGACGCGCTGCTGCTGACAAGGAAAAGGGTA
CCGCCGATGATATTATGCAGAATGTCGATTGA
AA sequence
>Lus10028537 pacid=23164627 polypeptide=Lus10028537 locus=Lus10028537.g ID=Lus10028537.BGIv1.0 annot-version=v1.0
MKYNPRVSSSRRKNRKAHFTAPSSVRRVLMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTFKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGVHP
SKVVVTKLRLDKDRKSLLDRKAKGRAAADKEKGTADDIMQNVD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G49910 Translation protein SH3-like f... Lus10028537 0 1
AT1G23290 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Riboso... Lus10016336 1.0 0.9710
AT3G49910 Translation protein SH3-like f... Lus10011540 1.7 0.9578
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10006207 2.2 0.9345
AT4G27490 3'-5'-exoribonuclease family p... Lus10037395 2.6 0.9243
AT5G48760 Ribosomal protein L13 family p... Lus10007137 3.2 0.9623
AT5G43970 ATTOM22-V, TOM2... TRANSLOCASE OUTER MITOCHONDRIA... Lus10022876 3.5 0.9334
AT1G20300 Pentatricopeptide repeat (PPR)... Lus10037533 4.7 0.9136
AT5G44500 Small nuclear ribonucleoprotei... Lus10038421 5.7 0.9196
AT4G38100 unknown protein Lus10012739 6.0 0.8656
AT3G15000 cobalt ion binding (.1) Lus10032618 6.5 0.9109

Lus10028537 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.