Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11050 77 / 2e-17 Protein kinase superfamily protein (.1) AT3G53380 53 / 6e-09 Concanavalin A-like lectin protein kinase family protein (.1) AT5G03140 49 / 2e-07 Concanavalin A-like lectin protein kinase family protein (.1) AT1G56140 49 / 2e-07 Leucine-rich repeat transmembrane protein kinase (.1) AT2G48010 48 / 4e-07 RKF3 receptor-like kinase in in flowers 3 (.1) AT5G55830 47 / 5e-07 Concanavalin A-like lectin protein kinase family protein (.1) AT1G56120 47 / 8e-07 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29720 45 / 2e-06 Leucine-rich repeat transmembrane protein kinase (.1) AT1G56130 45 / 3e-06 Leucine-rich repeat transmembrane protein kinase (.1) AT5G06740 43 / 2e-05 Concanavalin A-like lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018860 [exp] 118 / 1e-32 AT1G11050 384 / 6e-129 Protein kinase superfamily protein (.1) Lus10028551 [exp] 113 / 5e-30 AT1G11050 442 / 2e-148 Protein kinase superfamily protein (.1) Lus10028552 [exp] 105 / 4e-27 AT1G11050 463 / 1e-156 Protein kinase superfamily protein (.1) Lus10029714 [exp] 103 / 2e-26 AT1G11050 411 / 6e-137 Protein kinase superfamily protein (.1) Lus10018855 [exp] 102 / 2e-26 AT1G11050 473 / 7e-163 Protein kinase superfamily protein (.1) Lus10018861 [exp] 101 / 6e-26 AT1G11050 465 / 4e-157 Protein kinase superfamily protein (.1) Lus10028549 [exp] 100 / 6e-26 AT1G11050 448 / 8e-155 Protein kinase superfamily protein (.1) Lus10029711 [exp] 91 / 3e-22 AT1G11050 549 / 0.0 Protein kinase superfamily protein (.1) Lus10027972 [exp] 70 / 6e-15 AT2G48010 601 / 0.0 receptor-like kinase in in flowers 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G181800 [exp] 93 / 5e-23 AT1G11050 604 / 0.0 Protein kinase superfamily protein (.1) Potri.017G133000 [exp] 81 / 9e-19 AT1G11050 830 / 0.0 Protein kinase superfamily protein (.1) Potri.017G132800 [exp] 81 / 9e-19 AT1G11050 805 / 0.0 Protein kinase superfamily protein (.1) Potri.017G132250 [exp] 80 / 1e-18 AT1G11050 430 / 2e-148 Protein kinase superfamily protein (.1) Potri.004G084900 [exp] 77 / 3e-17 AT1G11050 821 / 0.0 Protein kinase superfamily protein (.1) Potri.014G136400 [exp] 63 / 2e-12 AT2G48010 794 / 0.0 receptor-like kinase in in flowers 3 (.1) Potri.014G136466 [exp] 60 / 2e-11 AT2G48010 792 / 0.0 receptor-like kinase in in flowers 3 (.1) Potri.016G087800 [exp] 59 / 7e-11 AT3G53380 881 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.005G040200 [exp] 54 / 4e-09 AT2G48010 613 / 0.0 receptor-like kinase in in flowers 3 (.1) Potri.003G094700 [exp] 54 / 4e-09 AT5G10530 764 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028553 pacid=23164525 polypeptide=Lus10028553 locus=Lus10028553.g ID=Lus10028553.BGIv1.0 annot-version=v1.0 ATGACAGCAAGGAGAGTTATCGACACGTCCTCCTCGAGCAGCTCGTCTTTGATAACAGAATGGGCGTGGAACTTGGAGAAGGTAGGTAAAGCAGGAGACA TTTTCGATGAGGCCATGAAGAATGATGTGGAGTGTAATGGTAGCGAGATGAGAAGGTTTGTTATGGTGGCGATTCATTGTGCACACGTAGTTGCTGCTAG TAGGCCTACCATTACTGAAGCTCTCAGGATGCTCGAAGGTGACATGAAAGCCCCCACATTGCCTAACCGGCCACCGCGGATGTCTCTTGAGCTGTTGACT TTAGGTGTAGCGAGTTTATGTACCTTGTCATGTCAAAGTCTAGCAGTGGGCAATGAAATTTACATCATTGGAAGACTACTCATGTAG
AA sequence Show only first row Show all	>Lus10028553 pacid=23164525 polypeptide=Lus10028553 locus=Lus10028553.g ID=Lus10028553.BGIv1.0 annot-version=v1.0 MTARRVIDTSSSSSSSLITEWAWNLEKVGKAGDIFDEAMKNDVECNGSEMRRFVMVAIHCAHVVAASRPTITEALRMLEGDMKAPTLPNRPPRMSLELLT LGVASLCTLSCQSLAVGNEIYIIGRLLM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11050			Protein kinase superfamily pro...		Lus10028553 [exp]	0	1
AT1G11050			Protein kinase superfamily pro...		Lus10028554 [exp]	1.0	0.9678
AT4G37710			VQ motif-containing protein (....		Lus10011555 [exp]	2.0	0.9489
AT3G28960			Transmembrane amino acid trans...		Lus10023029 [exp]	4.5	0.9277
AT1G76750			Protein of unknown function (D...		Lus10004548 [exp]	4.9	0.9256
AT2G44450		BGLU15	beta glucosidase 15 (.1)		Lus10031235 [exp]	11.2	0.9354
AT1G68765		IDA	INFLORESCENCE DEFICIENT IN ABS...		Lus10034385 [exp]	11.5	0.9423
AT5G44390			FAD-binding Berberine family p...		Lus10038442 [exp]	11.6	0.9473
					Lus10010270 [exp]	11.7	0.9322
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10008606 [exp]	11.9	0.8780
AT5G02500		AtHsp70-1, AT-H...	HEAT SHOCK PROTEIN 70-1, ARABI...		Lus10040300 [exp]	12.2	0.8951

Compare expression of checked genes

Lus10028553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.