Lus10028556 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G31180 72 / 4e-15 Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1.2)
AT4G26870 68 / 9e-14 Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018862 212 / 1e-66 AT4G31180 667 / 0.0 Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G085400 132 / 1e-36 AT4G31180 709 / 0.0 Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10028556 pacid=23164619 polypeptide=Lus10028556 locus=Lus10028556.g ID=Lus10028556.BGIv1.0 annot-version=v1.0
ATGTCATCATCATCCGAACCACAGAATCCACCGCCGGAGCAAGGCGAGGACGCCAAGGCCGTCAGCAAGAAGGCTGCGAATAAGGAAAAGGCAAAGGCGA
AGAAGGAGGCGGCGAAGAAGGCGGCAAAGAATGCGGAGTCCGCCGCCTTGCAGAACGCCACGTCCTCCCTCTCCGTCAACGACGCTGAGGATCCTCTCGC
CGGAAACTACGGCGATGTGCCGCTCAAGGATCTGCAGTCCGAGCATGTAGCCGATGCCAGCTCTTGGACGGAAGTGAGCGAGCTGAATGAGGAATCGAAG
GGCAAGGATGTTGTGTTCAGGGGTCGGGCGCAGACTGTTCGACCGGTAGGGAAGAATATGGCGTTTGTGGTGGTGAGACAGAGATTCTGGACAGTGCAGT
GTGTTGTTACTGCTCAGCCTAACCTCGTCAGCCGGCAGATGGTCAAGTTTGTCTCCGGTTTGAGCAGTAGACTGTTCGCCCGGGAGGGAAGAGTATGGAG
TTTGTGGTGGTGA
AA sequence
>Lus10028556 pacid=23164619 polypeptide=Lus10028556 locus=Lus10028556.g ID=Lus10028556.BGIv1.0 annot-version=v1.0
MSSSSEPQNPPPEQGEDAKAVSKKAANKEKAKAKKEAAKKAAKNAESAALQNATSSLSVNDAEDPLAGNYGDVPLKDLQSEHVADASSWTEVSELNEESK
GKDVVFRGRAQTVRPVGKNMAFVVVRQRFWTVQCVVTAQPNLVSRQMVKFVSGLSSRLFAREGRVWSLWW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G31180 Class II aminoacyl-tRNA and bi... Lus10028556 0 1
AT2G29190 APUM2 pumilio 2 (.1.2) Lus10016513 4.7 0.7957
AT1G25350 OVA9 ovule abortion 9, glutamine-tR... Lus10034339 21.1 0.7452
AT4G24620 PGI1 phosphoglucose isomerase 1 (.1... Lus10015959 29.8 0.7102
AT5G62600 MOS14 modifier of snc1-1, 14, ARM re... Lus10004250 29.9 0.7562
AT1G80000 CASC3/Barentsz eIF4AIII bindin... Lus10011468 30.3 0.7253
AT5G22030 UBP8 ubiquitin-specific protease 8 ... Lus10013599 39.4 0.7235
AT4G02570 AXR6, ATCUL1 AUXIN RESISTANT 6, cullin 1 (.... Lus10028917 41.7 0.6994
AT5G42920 AtTHO5 THO complex, subunit 5 (.1.2) Lus10009754 42.0 0.7276
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Lus10008806 42.7 0.7113
AT4G10570 UBP9 ubiquitin-specific protease 9 ... Lus10008276 46.5 0.7006

Lus10028556 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.