Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31180 232 / 1e-74 Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1.2) AT4G26870 223 / 2e-71 Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) AT4G17300 73 / 1e-15 ATNS1, NS1, OVA8 ovule abortion 8, Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) AT5G56680 70 / 1e-14 SYNC1ARATH, SYNC1, EMB2755 EMBRYO DEFECTIVE 2755, Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) AT1G70980 67 / 1e-13 SYNC3, SYNC1 Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) AT3G07420 49 / 2e-07 ATNS2, SYNC2_ARATH, NS2 SYNTHETASE C2, asparaginyl-tRNA synthetase 2 (.1) AT4G33760 47 / 1e-06 tRNA synthetase class II (D, K and N) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018862 [exp] 261 / 6e-86 AT4G31180 667 / 0.0 Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1.2) Lus10028555 [exp] 256 / 1e-85 AT4G31180 606 / 0.0 Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1.2) Lus10012920 [exp] 68 / 9e-14 AT5G56680 799 / 0.0 EMBRYO DEFECTIVE 2755, Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) Lus10032704 [exp] 68 / 9e-14 AT5G56680 907 / 0.0 EMBRYO DEFECTIVE 2755, Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) Lus10008180 [exp] 57 / 2e-10 AT5G56680 268 / 2e-87 EMBRYO DEFECTIVE 2755, Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) Lus10007470 [exp] 58 / 3e-10 AT4G17300 873 / 0.0 ovule abortion 8, Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) Lus10025874 [exp] 53 / 1e-08 AT3G07420 604 / 0.0 SYNTHETASE C2, asparaginyl-tRNA synthetase 2 (.1) Lus10038228 [exp] 51 / 4e-08 AT3G07420 353 / 7e-118 SYNTHETASE C2, asparaginyl-tRNA synthetase 2 (.1) Lus10028945 [exp] 47 / 1e-06 AT4G17300 740 / 0.0 ovule abortion 8, Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G085400 [exp] 246 / 3e-80 AT4G31180 709 / 0.0 Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1.2) Potri.007G129800 [exp] 72 / 3e-15 AT4G17300 872 / 0.0 ovule abortion 8, Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) Potri.017G028800 [exp] 70 / 1e-14 AT4G17300 888 / 0.0 ovule abortion 8, Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) Potri.006G153900 [exp] 69 / 3e-14 AT5G56680 929 / 0.0 EMBRYO DEFECTIVE 2755, Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) Potri.018G070000 [exp] 69 / 4e-14 AT5G56680 931 / 0.0 EMBRYO DEFECTIVE 2755, Class II aminoacyl-tRNA and biotin synthetases superfamily protein (.1) Potri.002G249700 [exp] 49 / 2e-07 AT3G07420 654 / 0.0 SYNTHETASE C2, asparaginyl-tRNA synthetase 2 (.1) Potri.001G289001 [exp] 47 / 1e-06 AT4G33760 998 / 0.0 tRNA synthetase class II (D, K and N) family protein (.1) Potri.009G084300 [exp] 47 / 1e-06 AT4G33760 1004 / 0.0 tRNA synthetase class II (D, K and N) family protein (.1) Potri.018G090600 [exp] 42 / 4e-05 AT3G11710 937 / 0.0 lysyl-tRNA synthetase 1 (.1) Potri.006G166000 [exp] 42 / 6e-05 AT3G11710 936 / 0.0 lysyl-tRNA synthetase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0040 [flax] [poplar] tRNA_synt_II PF00152 [flax] [poplar] tRNA-synt_2 tRNA synthetases class II (D, K and N)
Representative CDS sequence Show only first row Show all	>Lus10028557 pacid=23164556 polypeptide=Lus10028557 locus=Lus10028557.g ID=Lus10028557.BGIv1.0 annot-version=v1.0 ATGCTCGAGGCGGCTGGAGAGAAAGTTGATCCCTATGGAGATCTGAACACTGAAACAGAAAGAATATTGGGCCAGCTAGTCTTGGAGAGGTACGGCACTG AGTTCTACATTCTTCACCGCTACCCGTTGAAAGTAAGGCCATTCTACACCATGCCGTGCCCCGATAATCCAGAATACAGTAACGCCTTCGATGTCTTCAT TCGAGGGAAAGAAATCATATCCGGTGGTCAGCGTATCCATGTGGCGGCTAAGCTCGAAGAACGCGCAAAGGTATGCGGGATCGATGTCAGCAAAATCTCG AGTTACATCGATCCCTTCAGATATGGCATGCATCCACATGGTGGGTTCGGAGCGGGGTTGGAGCGCGTCGTGATGCTCTTCTGCGGCCTGAATAACATCC GTATGTGTTCGATGTTCCCTCGTGACCCTCGTAGGCTTAAACCATGA
AA sequence Show only first row Show all	>Lus10028557 pacid=23164556 polypeptide=Lus10028557 locus=Lus10028557.g ID=Lus10028557.BGIv1.0 annot-version=v1.0 MLEAAGEKVDPYGDLNTETERILGQLVLERYGTEFYILHRYPLKVRPFYTMPCPDNPEYSNAFDVFIRGKEIISGGQRIHVAAKLEERAKVCGIDVSKIS SYIDPFRYGMHPHGGFGAGLERVVMLFCGLNNIRMCSMFPRDPRRLKP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31180			Class II aminoacyl-tRNA and bi...		Lus10028557 [exp]	0	1
AT5G51740			Peptidase family M48 family pr...		Lus10031682 [exp]	1.0	0.9998
AT4G20990		ATACA4, ACA4	A. THALIANA ALPHA CARBONIC ANH...		Lus10031027 [exp]	1.7	0.9864
					Lus10033479 [exp]	2.4	0.9943
AT5G52810			NAD(P)-binding Rossmann-fold s...		Lus10043176 [exp]	4.0	0.9406
					Lus10015244 [exp]	4.0	0.9858
AT3G07990		SCPL27	serine carboxypeptidase-like 2...		Lus10036516 [exp]	4.5	0.9788
AT1G65820			microsomal glutathione s-trans...		Lus10020792 [exp]	4.6	0.9475
AT5G26330			Cupredoxin superfamily protein...		Lus10006683 [exp]	5.5	0.9328
AT1G47790			F-box and associated interacti...		Lus10031533 [exp]	6.0	0.9624
AT1G07520	GRAS		GRAS family transcription fact...		Lus10037757 [exp]	12.0	0.8690

Compare expression of checked genes

Lus10028557 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.