Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53840 56 / 5e-10 F-box/RNI-like/FBD-like domains-containing protein (.1) AT1G60410 54 / 3e-09 F-box family protein (.1) AT1G67390 51 / 3e-08 F-box family protein (.1) AT3G51530 50 / 4e-08 F-box/RNI-like/FBD-like domains-containing protein (.1) AT1G16930 50 / 5e-08 F-box/RNI-like/FBD-like domains-containing protein (.1) AT3G26922 49 / 8e-08 F-box/RNI-like superfamily protein (.1) AT5G44950 49 / 2e-07 F-box/RNI-like/FBD-like domains-containing protein (.1) AT2G04230 47 / 4e-07 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) AT2G26030 47 / 5e-07 F-box/RNI-like/FBD-like domains-containing protein (.1.2.3) AT3G58920 47 / 5e-07 F-box/RNI-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018863 [exp] 187 / 9e-61 AT5G44950 62 / 1e-10 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10028722 [exp] 122 / 1e-33 AT2G42730 76 / 1e-14 F-box family protein (.1.2) Lus10003089 [exp] 111 / 2e-31 AT5G53840 54 / 3e-08 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10011268 [exp] 108 / 8e-31 AT5G41630 52 / 7e-08 F-box/RNI-like superfamily protein (.1) Lus10028721 [exp] 99 / 1e-27 AT5G53840 56 / 5e-10 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10028602 [exp] 93 / 1e-23 AT1G80960 50 / 1e-06 F-box and Leucine Rich Repeat domains containing protein (.1.2.3) Lus10005646 [exp] 77 / 2e-18 AT1G80960 57 / 1e-09 F-box and Leucine Rich Repeat domains containing protein (.1.2.3) Lus10005091 [exp] 60 / 2e-11 AT1G69010 149 / 5e-41 BES1-interacting Myc-like protein 2 (.1) Lus10042272 [exp] 51 / 3e-08 AT4G03220 65 / 4e-11 Protein with RNI-like/FBD-like domains (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G098700 [exp] 54 / 2e-09 AT1G80960 86 / 6e-18 F-box and Leucine Rich Repeat domains containing protein (.1.2.3) Potri.015G011200 [exp] 47 / 4e-07 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1) Potri.011G104100 [exp] 47 / 4e-07 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1) Potri.011G136200 [exp] 47 / 8e-07 AT1G56400 215 / 2e-64 F-box family protein (.1.2) Potri.011G104300 [exp] 46 / 1e-06 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1) Potri.011G104200 [exp] 45 / 2e-06 AT3G26922 97 / 2e-22 F-box/RNI-like superfamily protein (.1) Potri.011G024600 [exp] 44 / 5e-06 AT4G26350 95 / 9e-21 F-box/RNI-like/FBD-like domains-containing protein (.1) Potri.011G024300 [exp] 44 / 9e-06 AT3G49030 116 / 3e-28 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2) Potri.015G002001 [exp] 42 / 2e-05 AT2G04230 59 / 9e-10 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) Potri.001G322900 [exp] 42 / 5e-05 AT3G18150 166 / 1e-45 RNI-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10028558 pacid=23164449 polypeptide=Lus10028558 locus=Lus10028558.g ID=Lus10028558.BGIv1.0 annot-version=v1.0 ATGGCGGACTTGGACTCTGTTTCTACTGGAAAGGAAGCAAGTAAAGCTCTCTTTAATGGAGAAGAAGTTGAACTGGATAGGATTAGTGAGTTGCCCGATG AACTTCTCATCGATATTGTATCTCGTTTGGCTCTCGTTGAAGCCATTAGAGCTTCAGTCCTCTCAAGTAGGTGGATAAACTTGTGGAAATCAGCCGTTTC GGTGCTCGACTTTGATGCCTCGGAGGAGTTGCTAGCTATTGACAAGCGGATCCGCCTCGATTTTGAAAGAATAATTCATGAGAAGAGGCGCGGGCACATG AATTGGGTGAACGGGGTTGTAACCCAGATGCAACAGAGGCGCGGATACGACCTTAGGTTCCGCCAGAACTTTCAATGA
AA sequence Show only first row Show all	>Lus10028558 pacid=23164449 polypeptide=Lus10028558 locus=Lus10028558.g ID=Lus10028558.BGIv1.0 annot-version=v1.0 MADLDSVSTGKEASKALFNGEEVELDRISELPDELLIDIVSRLALVEAIRASVLSSRWINLWKSAVSVLDFDASEELLAIDKRIRLDFERIIHEKRRGHM NWVNGVVTQMQQRRGYDLRFRQNFQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51530			F-box/RNI-like/FBD-like domain...		Lus10028558 [exp]	0	1

Compare expression of checked genes

Lus10028558 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.