Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77350 145 / 2e-46 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018864 [exp] 177 / 1e-58 AT1G77350 194 / 9e-66 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G066600 [exp] 148 / 2e-47 AT1G77350 127 / 4e-39 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09775 [flax] [poplar] Keratin_assoc Keratinocyte-associated protein 2
Representative CDS sequence Show only first row Show all	>Lus10028559 pacid=23164618 polypeptide=Lus10028559 locus=Lus10028559.g ID=Lus10028559.BGIv1.0 annot-version=v1.0 ATGGCGGCGGGAGCTGGAAGTTCGATGCTTTATTCACTGCTTATGTTCACAGTCATTCTATCTCTGCAAGTGATCTACCGTGGCAAGCTGGCCTCTACTG AGTTGTTCACCATTCTTGGAGGGTTCATCAGCTCTCTCCTCTTCCTCCTCCTCTTAACCTTCATTGGTAATTTCCAGGAATCAAGTGGTACCAAGACCGG GTGGGGTGCAGTCATATTGGCCGAAGCTGTTGCCCTGGTCGCAGCCGGAACTGTCCATCGAGTGTGCATGACCACATGTTTCTTATTCTCAGCTGGGCTG CTGTACGAGGTCAACAAGCTTTCCGGAATTGCACAATCTAAAAGTGAATCGAAAACAAGGAGGCACTAA
AA sequence Show only first row Show all	>Lus10028559 pacid=23164618 polypeptide=Lus10028559 locus=Lus10028559.g ID=Lus10028559.BGIv1.0 annot-version=v1.0 MAAGAGSSMLYSLLMFTVILSLQVIYRGKLASTELFTILGGFISSLLFLLLLTFIGNFQESSGTKTGWGAVILAEAVALVAAGTVHRVCMTTCFLFSAGL LYEVNKLSGIAQSKSESKTRRH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G77350			unknown protein		Lus10028559 [exp]	0	1
AT3G18410			Complex I subunit NDUFS6 (.1.2...		Lus10009665 [exp]	4.9	0.8380
AT2G02050			NADH-ubiquinone oxidoreductase...		Lus10035094 [exp]	9.9	0.7885
AT3G18410			Complex I subunit NDUFS6 (.1.2...		Lus10009027 [exp]	14.4	0.8108
AT1G08480		SDH6	succinate dehydrogenase 6, unk...		Lus10008448 [exp]	16.9	0.8103
AT5G13450		ATP5	delta subunit of Mt ATP syntha...		Lus10016414 [exp]	17.3	0.7809
AT2G46800		ATMTP1, ZAT1, Z...	ZINC TRANSPORTER OF ARABIDOPSI...		Lus10030192 [exp]	19.0	0.8123
AT5G65270		AtRABA4a	RAB GTPase homolog A4A (.1)		Lus10025738 [exp]	19.8	0.7301
AT3G22590		PHP, CDC73	PLANT HOMOLOGOUS TO PARAFIBROM...		Lus10041198 [exp]	20.1	0.7988
AT3G02790	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10026839 [exp]	20.8	0.7978
AT3G05545			RING/U-box superfamily protein...		Lus10029886 [exp]	22.4	0.7668

Compare expression of checked genes

Lus10028559 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.