Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G43560 156 / 5e-49 ATY2 thioredoxin Y2 (.1) AT1G76760 154 / 3e-48 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT1G50320 87 / 1e-21 ATHX, ATX thioredoxin X (.1) AT3G15360 78 / 3e-18 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT2G15570 73 / 2e-16 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) AT3G51030 69 / 2e-15 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT1G59730 68 / 7e-15 ATH7 thioredoxin H-type 7 (.1) AT4G03520 68 / 1e-14 ATHM2 Thioredoxin superfamily protein (.1.2) AT5G39950 67 / 1e-14 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G03680 68 / 2e-14 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018875 [exp] 243 / 4e-83 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1) Lus10014798 [exp] 81 / 2e-19 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10040887 [exp] 81 / 3e-19 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10014277 [exp] 76 / 4e-18 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10024293 [exp] 76 / 7e-18 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10029755 [exp] 76 / 2e-17 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10042784 [exp] 76 / 2e-17 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029752 [exp] 76 / 2e-17 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10041799 [exp] 74 / 2e-17 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G066800 [exp] 171 / 5e-55 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1) Potri.005G193400 [exp] 166 / 8e-53 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1) Potri.007G074000 [exp] 86 / 3e-21 AT1G50320 201 / 3e-66 thioredoxin X (.1) Potri.001G401500 [exp] 82 / 8e-20 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.011G120700 [exp] 79 / 1e-18 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.005G058400 [exp] 79 / 1e-18 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.002G073000 [exp] 78 / 3e-18 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.017G076700 [exp] 74 / 3e-17 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.005G186800 [exp] 75 / 4e-17 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.009G100700 [exp] 73 / 1e-16 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10028569 pacid=23164527 polypeptide=Lus10028569 locus=Lus10028569.g ID=Lus10028569.BGIv1.0 annot-version=v1.0 ATGGCGATTTCTTCAATATCTGCTTCTTCATCAGTCGCTTCTTCATTCGGAACCTCCCACCGTCACTCTTCAAAGCTGTCTTCATTCTCGTCAGCGTCTC AGCTCCCACTTCAGCTGAAACCTAATCGGCTCCCCAAGTCCTGGATTTCTTCTCCCCCCGGACAATCTCGGATCCTCACAAAGGTGTCTGCAAAGAAGCA AAGCTTTGCCAACTTAGAAGAGCTGCTGGAGAATGCAGAGAAGCCTGTCTTGGTCGATTTTTATGCGACCTGGTGTGGGCCATGCCAGCTGATGGTCCCG ATCCTCGAGGAAGTCGGCAGCGTCTTGACAGATACGATCCAGGTGGTGAAAATCGACACCGAGAAGTATGTCAGCATTGCTAACCAGTATGATATCCAAG GACTGCCGACTTTCATCCTGTTCAAAGATGGGAAGCCTATCGATCGCTTCGAGGGTGCATTGCCTAAAGAGAAGCTCATCCAACGCATACAAAGCTCCCT CAACGTGAAGCAATCGTAA
AA sequence Show only first row Show all	>Lus10028569 pacid=23164527 polypeptide=Lus10028569 locus=Lus10028569.g ID=Lus10028569.BGIv1.0 annot-version=v1.0 MAISSISASSSVASSFGTSHRHSSKLSSFSSASQLPLQLKPNRLPKSWISSPPGQSRILTKVSAKKQSFANLEELLENAEKPVLVDFYATWCGPCQLMVP ILEEVGSVLTDTIQVVKIDTEKYVSIANQYDIQGLPTFILFKDGKPIDRFEGALPKEKLIQRIQSSLNVKQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76760		ATY1, TRX-Y1	thioredoxin Y1 (.1)		Lus10028569 [exp]	0	1
AT4G25080		CHLM	magnesium-protoporphyrin IX me...		Lus10036021 [exp]	4.8	0.9294
AT3G26710		CCB1	cofactor assembly of complex C...		Lus10031981 [exp]	5.1	0.9271
AT5G51545		LPA2	low psii accumulation2 (.1)		Lus10031131 [exp]	6.5	0.9055
AT3G56650			Mog1/PsbP/DUF1795-like photosy...		Lus10042812 [exp]	7.4	0.9151
AT3G55330		PPL1	PsbP-like protein 1 (.1)		Lus10003289 [exp]	8.4	0.9019
AT4G17560			Ribosomal protein L19 family p...		Lus10023720 [exp]	9.3	0.9201
AT4G17560			Ribosomal protein L19 family p...		Lus10014467 [exp]	11.2	0.9132
AT1G74970		TWN3, RPS9	ribosomal protein S9 (.1)		Lus10016295 [exp]	11.5	0.9008
AT1G68590			Ribosomal protein PSRP-3/Ycf65...		Lus10021693 [exp]	12.6	0.9165
AT4G05180		PSII-Q, PSBQ, P...	photosystem II subunit Q-2 (.1...		Lus10020071 [exp]	13.4	0.8952

Compare expression of checked genes

Lus10028569 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.