Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	No hit found
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04554 [flax] [poplar] Extensin_2 Extensin-like region
Representative CDS sequence Show only first row Show all	>Lus10028589 pacid=23164494 polypeptide=Lus10028589 locus=Lus10028589.g ID=Lus10028589.BGIv1.0 annot-version=v1.0 ATGTACAAGTACAAGTCACCACCACCACCAACAAAGCCATACAAGTACAAGTCACCACCACCACCGCCGGTCTACAAGTCTCCTCCGCCACCGGTTTACA AGTACAAGTCACCGCCGCCGCCGGTGCACAAGCCACCTCCGCATTACATCTATGCTTCACCTCCTCCACCACACCACGTCTAG
AA sequence Show only first row Show all	>Lus10028589 pacid=23164494 polypeptide=Lus10028589 locus=Lus10028589.g ID=Lus10028589.BGIv1.0 annot-version=v1.0 MYKYKSPPPPTKPYKYKSPPPPPVYKSPPPPVYKYKSPPPPVHKPPPHYIYASPPPPHHV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10028589 [exp]	0	1
					Lus10018893 [exp]	1.4	0.9729
					Lus10010742 [exp]	5.1	0.9172
AT5G56350			Pyruvate kinase family protein...		Lus10003439 [exp]	7.1	0.9427
AT1G14550			Peroxidase superfamily protein...		Lus10009898 [exp]	8.0	0.9314
					Lus10018894 [exp]	9.3	0.9576
AT1G17860			Kunitz family trypsin and prot...		Lus10011090 [exp]	11.0	0.9426
AT5G08380		ATAGAL1	alpha-galactosidase 1 (.1)		Lus10017365 [exp]	11.7	0.9003
AT1G73990		SPPA1, SPPA	signal peptide peptidase (.1)		Lus10013332 [exp]	17.6	0.9298
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10037209 [exp]	22.8	0.9156
AT1G71695			Peroxidase superfamily protein...		Lus10028735 [exp]	24.4	0.9320

Compare expression of checked genes

Lus10028589 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.