Lus10028601 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028722 102 / 2e-26 AT2G42730 76 / 1e-14 F-box family protein (.1.2)
Lus10028649 100 / 2e-25 AT1G21380 452 / 7e-152 Target of Myb protein 1 (.1)
Lus10018912 89 / 8e-22 ND /
Lus10028626 78 / 2e-18 AT5G48920 51 / 7e-08 tracheary element differentiation-related 7 (.1)
Lus10021237 78 / 3e-18 ND /
Lus10011267 78 / 7e-18 ND 39 / 0.002
Lus10028610 71 / 2e-16 ND /
Lus10031019 39 / 0.0003 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10028601 pacid=23164606 polypeptide=Lus10028601 locus=Lus10028601.g ID=Lus10028601.BGIv1.0 annot-version=v1.0
ATGACCTTAGGTAACGAGTTTATTTGCAGCGAAATGTTTAGAGGCCTTTCAGGATGCGTTGGCCGATTGGTGTCCCTCTTGTTGAAGTCGTACCACCAAT
TACGTTCGAGCCAGCCTGGGTTGCAGTTACATCAACTGCGTGAGGATGTGGTTAAAGTACGCCGGGATAGCATCAAAGTGGTGGAGGTTTTTGGGTTTCG
TGGTAACAAGATGGAGTGCAAGTTTATGGAGTACGTGCTGAAATATTTTGCGGGGTTAGAAAAAATAGTGATTGATTGGTCGACTACTTCTATCTTTTCT
GATGACAGTATTTTCACTTATGTACGGAATGGGGGAGTTGGCCCTGAAGCCGAAAAGGCTGCGTTGGAGCTGAAATCACAAGCACCCCCAACAGTTGAAG
TCGTTTTAATTTAG
AA sequence
>Lus10028601 pacid=23164606 polypeptide=Lus10028601 locus=Lus10028601.g ID=Lus10028601.BGIv1.0 annot-version=v1.0
MTLGNEFICSEMFRGLSGCVGRLVSLLLKSYHQLRSSQPGLQLHQLREDVVKVRRDSIKVVEVFGFRGNKMECKFMEYVLKYFAGLEKIVIDWSTTSIFS
DDSIFTYVRNGGVGPEAEKAALELKSQAPPTVEVVLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10028601 0 1
AT1G75130 CYP721A1 "cytochrome P450, family 721, ... Lus10010802 11.9 0.7755
AT4G31970 CYP82C2, JAH1 "cytochrome P450, family 82, s... Lus10038201 19.6 0.7372
AT3G14620 CYP72A8 "cytochrome P450, family 72, s... Lus10026681 20.3 0.7711
AT1G66520 PDE194 pigment defective 194, formylt... Lus10000450 25.0 0.7689
Lus10011613 28.1 0.6730
AT5G59510 RTFL5, DVL18 DEVIL 18, ROTUNDIFOLIA like 5 ... Lus10001569 55.6 0.7271
AT5G54650 ATFH5, Fh5 FORMIN HOMOLOGY 5, formin homo... Lus10039705 59.5 0.7277
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Lus10006360 59.5 0.7037
AT2G24210 AtTPS10 terpene synthase 10 (.1) Lus10006355 67.4 0.7222
AT3G59160 F-box/RNI-like superfamily pro... Lus10003943 81.0 0.7054

Lus10028601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.