Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78780 38 / 0.0001 pathogenesis-related family protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018919 [exp] 76 / 1e-18 AT1G78780 239 / 1e-79 pathogenesis-related family protein (.1.2.3.4) Lus10035732 [exp] 42 / 6e-06 AT1G78780 249 / 2e-85 pathogenesis-related family protein (.1.2.3.4) Lus10039018 [exp] 42 / 8e-06 AT1G78780 301 / 6e-104 pathogenesis-related family protein (.1.2.3.4) Lus10037316 [exp] 40 / 4e-05 AT1G78780 337 / 9e-118 pathogenesis-related family protein (.1.2.3.4) Lus10042792 [exp] 38 / 7e-05 AT1G78780 115 / 1e-33 pathogenesis-related family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G188300 [exp] 45 / 7e-07 AT1G78780 251 / 2e-84 pathogenesis-related family protein (.1.2.3.4) Potri.005G188400 [exp] 44 / 1e-06 AT1G78780 249 / 1e-83 pathogenesis-related family protein (.1.2.3.4) Potri.011G108900 [exp] 40 / 2e-05 AT1G78780 365 / 4e-129 pathogenesis-related family protein (.1.2.3.4) Potri.001G389400 [exp] 39 / 8e-05 AT1G78780 352 / 4e-124 pathogenesis-related family protein (.1.2.3.4) Potri.001G389800 [exp] 38 / 0.0001 AT1G78780 361 / 9e-128 pathogenesis-related family protein (.1.2.3.4)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028620 pacid=23164565 polypeptide=Lus10028620 locus=Lus10028620.g ID=Lus10028620.BGIv1.0 annot-version=v1.0 ATGGAAGGTCCTTTCAAAGGGCATGCTCCGACCGGTGAGCTGGTTGAGCTTTTCGGAATCGGAATCTTTCAGGTGGATGAGGAGATGGAGAAGGTTGAGA AAGTTGAGTTCTTCTTTGACCGTGGAGAGTTGCTTGGAGGGCTTATGAAAGGTGGTAAAGTTGAGTTTGATGGTGCAGGGGATACTACAGGGTGCCCTTT CCTGAATCAAACCGGCTAG
AA sequence Show only first row Show all	>Lus10028620 pacid=23164565 polypeptide=Lus10028620 locus=Lus10028620.g ID=Lus10028620.BGIv1.0 annot-version=v1.0 MEGPFKGHAPTGELVELFGIGIFQVDEEMEKVEKVEFFFDRGELLGGLMKGGKVEFDGAGDTTGCPFLNQTG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G78780			pathogenesis-related family pr...		Lus10028620 [exp]	0	1
AT1G78780			pathogenesis-related family pr...		Lus10018919 [exp]	1.0	0.9557
AT5G38200			Class I glutamine amidotransfe...		Lus10009152 [exp]	3.9	0.8603
AT1G07180		NDA1, ATNDI1	ARABIDOPSIS THALIANA INTERNAL ...		Lus10006731 [exp]	4.0	0.8718
AT1G07180		NDA1, ATNDI1	ARABIDOPSIS THALIANA INTERNAL ...		Lus10020091 [exp]	11.6	0.8504
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10010874 [exp]	16.1	0.8474
AT1G51340			MATE efflux family protein (.1...		Lus10016412 [exp]	16.5	0.8112
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Lus10029453 [exp]	18.2	0.8335
AT5G42020		BIP2, BIP	luminal binding protein, Heat ...		Lus10007778 [exp]	19.5	0.8595
AT3G13050		AtNiaP	nicotinate transporter, Major ...		Lus10033336 [exp]	20.6	0.8503
AT5G18170		GDH1	glutamate dehydrogenase 1 (.1)		Lus10003858 [exp]	24.8	0.8455

Compare expression of checked genes

Lus10028620 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.