Lus10028629 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02680 162 / 9e-53 TAF13 TBP-associated factor 13 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018927 225 / 4e-77 AT1G02680 159 / 2e-51 TBP-associated factor 13 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G122500 182 / 2e-60 AT1G02680 169 / 2e-55 TBP-associated factor 13 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF02269 TFIID-18kDa Transcription initiation factor IID, 18kD subunit
Representative CDS sequence
>Lus10028629 pacid=23164602 polypeptide=Lus10028629 locus=Lus10028629.g ID=Lus10028629.BGIv1.0 annot-version=v1.0
ATGAGCGGCTCCGGAACTCCTGGACAGGCACCCAAATCCTCAAAGGTCGCTGGCGCTTCGTCACACTCGTCGGAACCTTTTACTAAGAGGAAACGAGGAG
TCTTCCAGAAAGATTTGCAGCATATGATGTATGGATTTGGAGACGATCCTAATCCGCTTCCGGAAAGTTTAGCACTCCTGGAGGACATTGTTGTAGAGTA
TGTCACTGATCTGACACATAAAGCACTTGACGTTGGATCGAAAAGGGCGAGAATTTCAGTCGAGGATTTCCTGTACTTGATTCGCAAGGACCCACCAAAG
CTCAACCGATGTACGGAACTGCTTTCGATGCAAGAGGAGCTGAAACAAGCAAGGAAAGCTTTCGACATGGATGACGAGAAACGGGTACTCGAGTAA
AA sequence
>Lus10028629 pacid=23164602 polypeptide=Lus10028629 locus=Lus10028629.g ID=Lus10028629.BGIv1.0 annot-version=v1.0
MSGSGTPGQAPKSSKVAGASSHSSEPFTKRKRGVFQKDLQHMMYGFGDDPNPLPESLALLEDIVVEYVTDLTHKALDVGSKRARISVEDFLYLIRKDPPK
LNRCTELLSMQEELKQARKAFDMDDEKRVLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02680 TAF13 TBP-associated factor 13 (.1) Lus10028629 0 1
AT1G32310 unknown protein Lus10030955 1.7 0.9286
AT1G63855 Putative methyltransferase fam... Lus10041869 1.7 0.9058
AT3G49870 ATARLA1C ADP-ribosylation factor-like A... Lus10019259 4.0 0.9045
AT1G55160 unknown protein Lus10011503 6.8 0.9136
AT3G01980 NAD(P)-binding Rossmann-fold s... Lus10041545 8.9 0.9000
AT2G36410 Family of unknown function (DU... Lus10035563 15.9 0.8672
AT4G22740 glycine-rich protein (.1.2) Lus10024563 16.9 0.8813
AT2G20140 RPT2b regulatory particle AAA-ATPase... Lus10015524 18.1 0.8959
AT1G11740 ankyrin repeat family protein ... Lus10020036 20.8 0.8814
AT4G27745 Yippee family putative zinc-bi... Lus10033226 21.1 0.8678

Lus10028629 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.