Lus10028669 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18250 95 / 3e-23 receptor serine/threonine kinase, putative (.1)
AT1G70250 92 / 4e-22 receptor serine/threonine kinase, putative (.1)
AT5G38280 92 / 5e-22 PR5K PR5-like receptor kinase (.1)
AT5G38260 92 / 5e-22 Protein kinase superfamily protein (.1)
AT1G66920 90 / 2e-21 Protein kinase superfamily protein (.1.2)
AT5G38250 89 / 4e-21 Protein kinase family protein (.1)
AT5G39020 87 / 2e-20 Malectin/receptor-like protein kinase family protein (.1)
AT5G38240 87 / 2e-20 Protein kinase family protein (.1)
AT5G39030 87 / 4e-20 Protein kinase superfamily protein (.1)
AT1G66910 86 / 6e-20 Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007934 227 / 6e-72 AT5G38260 273 / 3e-83 Protein kinase superfamily protein (.1)
Lus10013472 212 / 1e-69 AT5G38280 177 / 2e-51 PR5-like receptor kinase (.1)
Lus10000854 187 / 2e-55 AT1G77320 796 / 0.0 meiosis defective 1, transcription coactivators (.1.2)
Lus10014923 103 / 3e-26 AT1G67000 335 / 2e-107 Protein kinase superfamily protein (.1)
Lus10022359 101 / 2e-25 AT1G66980 322 / 3e-101 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10025549 96 / 9e-25 AT1G66980 209 / 1e-62 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10008335 99 / 1e-24 AT1G70250 316 / 8e-98 receptor serine/threonine kinase, putative (.1)
Lus10025545 97 / 2e-24 AT5G39020 316 / 1e-101 Malectin/receptor-like protein kinase family protein (.1)
Lus10025492 97 / 6e-24 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G125500 143 / 2e-40 AT1G67000 309 / 3e-94 Protein kinase superfamily protein (.1)
Potri.010G118300 122 / 9e-33 AT1G66920 316 / 1e-99 Protein kinase superfamily protein (.1.2)
Potri.015G018000 112 / 5e-29 AT1G66920 355 / 2e-114 Protein kinase superfamily protein (.1.2)
Potri.012G003200 103 / 1e-27 AT1G66920 280 / 2e-90 Protein kinase superfamily protein (.1.2)
Potri.015G018200 106 / 4e-27 AT1G66920 368 / 1e-119 Protein kinase superfamily protein (.1.2)
Potri.007G125100 105 / 4e-27 AT1G66920 347 / 2e-113 Protein kinase superfamily protein (.1.2)
Potri.012G002800 104 / 2e-26 AT1G66920 346 / 2e-111 Protein kinase superfamily protein (.1.2)
Potri.012G003500 104 / 2e-26 AT1G66920 358 / 4e-116 Protein kinase superfamily protein (.1.2)
Potri.012G003000 104 / 2e-26 AT1G66920 356 / 5e-115 Protein kinase superfamily protein (.1.2)
Potri.017G035500 103 / 2e-26 AT1G66920 336 / 2e-107 Protein kinase superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10028669 pacid=23164505 polypeptide=Lus10028669 locus=Lus10028669.g ID=Lus10028669.BGIv1.0 annot-version=v1.0
ATGGAGAAAGACGGGCTAAAAAATTGTTTCAGTTTACAAAAATTCAAATATATCCTTGACGGATTAATTGATAAATGTCTGCTTCTTCCGGTTAGCTGGG
AGCAACTCAATCGGATCGCGATAGGGACGGCTCGAGCCATCTGCCATCTGCACGATGTCTCGTCGGTTCTTCATCTAGATATCAATCCTCGAAATGTCTT
GCTGGACATTGATTTCACTAAGAAAGTTGCAGATTTTGGCCTAGCCAAGTTGTGTAGTCGCGATCGCCTCTCCGGACGGTACATTGCACCGGAAGTGTTC
TCGGTTGACATCGAGGCCGTTTTGAGCAAATCAGCCTTCTACAGCTTCAGAATCCTGTTGTTAGGAATGGTCAAATCGAAGAGCAAGTGCTCTTCGGAGG
TCCTCTTTCCGATGTGGGTTCACGACCATCTGAGCAATGGGGGAGGCTTGAAGCTGGAGAATGTGACGGAAATCGATTGGATATCTCATATTTGA
AA sequence
>Lus10028669 pacid=23164505 polypeptide=Lus10028669 locus=Lus10028669.g ID=Lus10028669.BGIv1.0 annot-version=v1.0
MEKDGLKNCFSLQKFKYILDGLIDKCLLLPVSWEQLNRIAIGTARAICHLHDVSSVLHLDINPRNVLLDIDFTKKVADFGLAKLCSRDRLSGRYIAPEVF
SVDIEAVLSKSAFYSFRILLLGMVKSKSKCSSEVLFPMWVHDHLSNGGGLKLENVTEIDWISHI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G38260 Protein kinase superfamily pro... Lus10028669 0 1
AT5G46850 unknown protein Lus10030954 8.8 0.7534
AT4G15620 Uncharacterised protein family... Lus10041528 11.2 0.8536
AT4G37810 unknown protein Lus10007240 14.8 0.8419
AT1G13290 C2H2ZnF WIP6, DOT5 WIP domain protein 6, DEFECTIV... Lus10021700 16.2 0.8303
AT3G47570 Leucine-rich repeat protein ki... Lus10037311 16.2 0.8294
AT2G40435 unknown protein Lus10017415 29.7 0.8047
AT3G09870 SAUR-like auxin-responsive pro... Lus10030263 30.9 0.8253
AT1G63260 TET10 tetraspanin10 (.1.2.3) Lus10029562 31.1 0.8138
AT2G38140 PSRP4 plastid-specific ribosomal pro... Lus10004829 36.9 0.8236
AT5G62360 Plant invertase/pectin methyle... Lus10031138 37.1 0.8243

Lus10028669 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.