Lus10028670 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17970 249 / 4e-81 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT4G36090 243 / 1e-78 oxidoreductase, 2OG-Fe(II) oxygenase family protein (.1), oxidoreductase, 2OG-Fe(II) oxygenase family protein (.2), oxidoreductase, 2OG-Fe(II) oxygenase family protein (.3)
AT1G48980 239 / 2e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein
AT2G48080 89 / 3e-20 oxidoreductase, 2OG-Fe(II) oxygenase family protein (.1)
AT4G02940 81 / 2e-17 oxidoreductase, 2OG-Fe(II) oxygenase family protein (.1)
AT1G14710 81 / 3e-17 hydroxyproline-rich glycoprotein family protein (.1.2)
AT1G20570 79 / 7e-17 Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
AT1G80260 77 / 3e-16 EMB1427 embryo defective 1427, Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028462 262 / 3e-85 AT2G17970 542 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Lus10041917 258 / 1e-83 AT2G17970 549 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Lus10018892 127 / 2e-33 AT1G80260 919 / 0.0 embryo defective 1427, Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
Lus10028588 127 / 4e-33 AT1G80260 942 / 0.0 embryo defective 1427, Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
Lus10029637 85 / 1e-18 AT4G02940 503 / 4e-174 oxidoreductase, 2OG-Fe(II) oxygenase family protein (.1)
Lus10008166 83 / 4e-18 AT4G02940 511 / 2e-177 oxidoreductase, 2OG-Fe(II) oxygenase family protein (.1)
Lus10027990 83 / 4e-18 AT4G02940 535 / 0.0 oxidoreductase, 2OG-Fe(II) oxygenase family protein (.1)
Lus10042669 80 / 5e-17 AT4G02940 498 / 5e-172 oxidoreductase, 2OG-Fe(II) oxygenase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G114800 251 / 6e-81 AT2G17970 504 / 1e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Potri.007G012200 235 / 9e-75 AT2G17970 458 / 2e-157 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Potri.010G102100 96 / 2e-22 AT1G14710 421 / 3e-139 hydroxyproline-rich glycoprotein family protein (.1.2)
Potri.008G138900 91 / 1e-20 AT1G14710 423 / 6e-140 hydroxyproline-rich glycoprotein family protein (.1.2)
Potri.016G000100 62 / 8e-11 AT1G80260 431 / 3e-137 embryo defective 1427, Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
Potri.014G137700 61 / 1e-10 AT4G02940 542 / 0.0 oxidoreductase, 2OG-Fe(II) oxygenase family protein (.1)
Potri.014G184801 42 / 0.0001 AT1G80260 321 / 8e-103 embryo defective 1427, Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
CL0540 GCP PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal
Representative CDS sequence
>Lus10028670 pacid=23164639 polypeptide=Lus10028670 locus=Lus10028670.g ID=Lus10028670.BGIv1.0 annot-version=v1.0
ATGGTGGATCGTATACCTCACCTTTTCAAGGTGATGATAATGAGGCTCATTAGATGGCATGTTCTGCCTCCGACATGCGTACCAGACAGCTGTATCGTCA
ACATCTACGAGGAAGGGGATTGCATTCCACCCCACATCGACCACCATGATTTTCTCCGACCATTCTGTACGGTATCCTTTGTTAGCCAGTGCAATATAGT
ATTTGGGACCGACATAAAGGGTACGACCCCCGGTGAGTTCTCCGGATCATTGGCAATTCCTTTACCAGTTGGCTCTGTGCTTGTACTGAATGGAAATGGA
GCTGATGTAGCTAAACATTGTGTGCCGTCAGTCCCAACAAAGAGGATATCGATCACTTTCCGAAAGATGGATCCCGCAAAACGGCCTCGTGGTTTTGTTC
CAGAGCCTGATCTGAAGGGACTTGAGCCAGGGAAGGATAGTAGTGATGAAGATTTGAAAGATGCCCCTGCTGATGATTTTGCTTTTGCTATGTTGATTCG
GGAATCCATTAGGAACTCTGCAGATTCATTAGTTGTCACCATTACAAAAAGTAAAGGTTTGGATGGTGATGAGCGTACCTCAACTTGTAGAAGTAATCCT
CACAACTCCGTACTTGACGCCCTTGCTTCATTGAACTTCACTTACAAGGTTTCGTGGCCATTGGAACTGATTGCGAACGCAGAAGTCATCAAGAAGTACA
ACCAGGTACACTCCCACTAG
AA sequence
>Lus10028670 pacid=23164639 polypeptide=Lus10028670 locus=Lus10028670.g ID=Lus10028670.BGIv1.0 annot-version=v1.0
MVDRIPHLFKVMIMRLIRWHVLPPTCVPDSCIVNIYEEGDCIPPHIDHHDFLRPFCTVSFVSQCNIVFGTDIKGTTPGEFSGSLAIPLPVGSVLVLNGNG
ADVAKHCVPSVPTKRISITFRKMDPAKRPRGFVPEPDLKGLEPGKDSSDEDLKDAPADDFAFAMLIRESIRNSADSLVVTITKSKGLDGDERTSTCRSNP
HNSVLDALASLNFTYKVSWPLELIANAEVIKKYNQVHSH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G17970 2-oxoglutarate (2OG) and Fe(II... Lus10028670 0 1
AT3G22590 PHP, CDC73 PLANT HOMOLOGOUS TO PARAFIBROM... Lus10026680 9.1 0.9000
AT3G23250 MYB ATMYB15, ATY19 myb domain protein 15 (.1.2) Lus10039736 13.3 0.8979
AT1G71691 GDSL-like Lipase/Acylhydrolase... Lus10009455 15.9 0.8953
AT3G63480 ATP binding microtubule motor ... Lus10035344 15.9 0.8899
AT4G31380 FLP1 FPF1-like protein 1 (.1) Lus10040802 16.2 0.8842
Lus10006724 18.2 0.8959
AT2G26520 unknown protein Lus10021765 19.9 0.8947
AT4G37750 AP2_ERF DRG, CKC1, ANT DRAGON, COMPLEMENTING A PROTEI... Lus10039650 20.8 0.8834
AT5G04530 KCS19 3-ketoacyl-CoA synthase 19 (.1... Lus10040333 29.0 0.8852
AT5G53950 NAC ATCUC2, CUC2, A... CUP-SHAPED COTYLEDON 2, Arabid... Lus10041924 38.9 0.8821

Lus10028670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.