Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036565 [exp] 169 / 2e-56 ND / Lus10000976 [exp] 166 / 5e-55 ND / Lus10005265 [exp] 161 / 2e-53 ND / Lus10000320 [exp] 166 / 2e-52 ND / Lus10020608 [exp] 155 / 7e-51 ND / Lus10015702 [exp] 157 / 1e-50 ND 38 / 0.004 Lus10032804 [exp] 157 / 2e-50 ND / Lus10003364 [exp] 154 / 2e-50 ND / Lus10000801 [exp] 160 / 7e-50 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028673 pacid=23164470 polypeptide=Lus10028673 locus=Lus10028673.g ID=Lus10028673.BGIv1.0 annot-version=v1.0 ATGTTCGAGAGGGCAGTGTCCGGGGCGGATGTTGCTCCAGGGTACATGGACTGGTACCTCGAGCACAGTCACCTGCGCATCGTAGCACCGGCCAACCCCG GTGTAGACGTCCCACCTGAGATTATTACACAGCGAGTCTTCGATGGTATGTCCTCTTACTCCGATGGTACGTTTGCGCGGCAGCATGCGGACTCGCCTAA GGAGTACTACGACCACTTGGAGGGGATACGCATGCAGTTTCAGGACCTCTACATGGGGTATCGGAGCCAGAGAGAGAGTCGAGATTAG
AA sequence Show only first row Show all	>Lus10028673 pacid=23164470 polypeptide=Lus10028673 locus=Lus10028673.g ID=Lus10028673.BGIv1.0 annot-version=v1.0 MFERAVSGADVAPGYMDWYLEHSHLRIVAPANPGVDVPPEIITQRVFDGMSSYSDGTFARQHADSPKEYYDHLEGIRMQFQDLYMGYRSQRESRD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10028673 [exp]	0	1
					Lus10022068 [exp]	1.4	0.8961
					Lus10021381 [exp]	3.0	0.8798
AT1G53830		ATPME2	pectin methylesterase 2 (.1)		Lus10027556 [exp]	7.9	0.8821
AT3G22400		ATLOX5, LOX5	Arabidopsis thaliana lipoxygen...		Lus10008041 [exp]	8.5	0.8351
AT5G40350	MYB	ATMYB24	myb domain protein 24 (.1)		Lus10014557 [exp]	11.5	0.8637
AT2G36620		RPL24A	ribosomal protein L24 (.1)		Lus10014637 [exp]	13.6	0.8398
					Lus10033534 [exp]	14.9	0.8398
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10030911 [exp]	16.1	0.8398
					Lus10039990 [exp]	17.2	0.8398
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10038876 [exp]	18.2	0.8398

Compare expression of checked genes

Lus10028673 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.