Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19990 73 / 2e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038848 [exp] 79 / 2e-18 AT3G19990 536 / 0.0 unknown protein Lus10017359 [exp] 77 / 1e-17 AT3G19990 592 / 0.0 unknown protein Lus10010154 [exp] 76 / 3e-17 AT3G19990 583 / 0.0 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G001200 [exp] 79 / 3e-18 AT3G19990 632 / 0.0 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028681 pacid=23164620 polypeptide=Lus10028681 locus=Lus10028681.g ID=Lus10028681.BGIv1.0 annot-version=v1.0 ATGTACTGGCGAGGTATTTGTGGGAATGCCTCAAAAAAGAAGGAAGTGGAAGAGGACTTGAAGGGTAGTTTGGTAAATAACCCATACCTCGGCGATCCCT TTTTGGTGTTAGCTCAAGTTTACCTAGCGAAAGGGAAGTTCGAAAAGGCGGAGGAGGCGGCGGCGACGGGGCTAGAGTTGTTGCTCGAGTGGGGGACGAC GTGGGACAAGAGGAAGTCATGGGAAGGATGGGTTGCGTGGGGTAGGGTTTTGTTGTCGAAGGCTAAGCTTAAGTCGTGGCCTCCAACACAATGGAAGGTT CATAGTCTAGGGCTTAAAAAGGACATGTAG
AA sequence Show only first row Show all	>Lus10028681 pacid=23164620 polypeptide=Lus10028681 locus=Lus10028681.g ID=Lus10028681.BGIv1.0 annot-version=v1.0 MYWRGICGNASKKKEVEEDLKGSLVNNPYLGDPFLVLAQVYLAKGKFEKAEEAAATGLELLLEWGTTWDKRKSWEGWVAWGRVLLSKAKLKSWPPTQWKV HSLGLKKDM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19990			unknown protein		Lus10028681 [exp]	0	1
AT5G54370			Late embryogenesis abundant (L...		Lus10033540 [exp]	1.4	0.9895
AT3G19990			unknown protein		Lus10028680 [exp]	2.8	0.9894
AT5G54370			Late embryogenesis abundant (L...		Lus10017577 [exp]	3.9	0.9875
AT5G54370			Late embryogenesis abundant (L...		Lus10031297 [exp]	3.9	0.9818
AT5G40830		ATRAD3, ATATR	S-adenosyl-L-methionine-depend...		Lus10020803 [exp]	4.9	0.9835
AT4G32890	GATA	GATA9	GATA transcription factor 9 (....		Lus10011430 [exp]	6.9	0.9817
AT3G01516			unknown protein		Lus10014544 [exp]	7.2	0.9621
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Lus10011746 [exp]	8.5	0.9774
AT3G20820			Leucine-rich repeat (LRR) fami...		Lus10031377 [exp]	8.8	0.9795
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10041707 [exp]	11.2	0.9755

Compare expression of checked genes

Lus10028681 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.