Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09890 71 / 8e-18 Protein of unknown function (DUF3511) (.1) AT2G47480 56 / 1e-11 Protein of unknown function (DUF3511) (.1) AT5G11970 54 / 5e-11 Protein of unknown function (DUF3511) (.1) AT3G62640 51 / 6e-10 Protein of unknown function (DUF3511) (.1) AT2G19460 51 / 1e-09 Protein of unknown function (DUF3511) (.1) AT1G72720 47 / 4e-08 Protein of unknown function (DUF3511) (.1) AT3G05725 46 / 1e-07 Protein of unknown function (DUF3511) (.1) AT3G13910 45 / 1e-07 Protein of unknown function (DUF3511) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028734 [exp] 130 / 2e-41 AT4G09890 69 / 8e-17 Protein of unknown function (DUF3511) (.1) Lus10020842 [exp] 68 / 3e-16 AT4G09890 69 / 2e-16 Protein of unknown function (DUF3511) (.1) Lus10033529 [exp] 66 / 9e-16 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) Lus10005802 [exp] 64 / 3e-15 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10006799 [exp] 64 / 6e-15 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) Lus10011939 [exp] 61 / 2e-13 AT2G19460 109 / 6e-32 Protein of unknown function (DUF3511) (.1) Lus10027629 [exp] 61 / 3e-13 AT2G19460 110 / 2e-32 Protein of unknown function (DUF3511) (.1) Lus10017155 [exp] 51 / 1e-09 AT5G11970 93 / 1e-25 Protein of unknown function (DUF3511) (.1) Lus10021581 [exp] 50 / 2e-09 AT5G11970 97 / 4e-27 Protein of unknown function (DUF3511) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G195800 [exp] 77 / 5e-20 AT4G09890 81 / 1e-21 Protein of unknown function (DUF3511) (.1) Potri.002G065200 [exp] 76 / 7e-20 AT4G09890 84 / 9e-23 Protein of unknown function (DUF3511) (.1) Potri.007G077500 [exp] 66 / 8e-16 AT4G09890 80 / 3e-21 Protein of unknown function (DUF3511) (.1) Potri.010G140800 [exp] 52 / 2e-10 AT2G47480 62 / 2e-14 Protein of unknown function (DUF3511) (.1) Potri.014G123600 [exp] 52 / 2e-10 AT2G47480 93 / 5e-26 Protein of unknown function (DUF3511) (.1) Potri.006G147700 [exp] 53 / 3e-10 AT2G19460 96 / 2e-26 Protein of unknown function (DUF3511) (.1) Potri.001G197700 [exp] 51 / 9e-10 AT2G19460 78 / 1e-19 Protein of unknown function (DUF3511) (.1) Potri.006G225900 [exp] 50 / 2e-09 AT5G11970 90 / 2e-24 Protein of unknown function (DUF3511) (.1) Potri.005G019900 [exp] 48 / 7e-09 AT3G05725 63 / 3e-14 Protein of unknown function (DUF3511) (.1) Potri.003G043600 [exp] 47 / 4e-08 AT5G11970 89 / 5e-24 Protein of unknown function (DUF3511) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12023 [flax] [poplar] DUF3511 Domain of unknown function (DUF3511)
Representative CDS sequence Show only first row Show all	>Lus10028690 pacid=23164492 polypeptide=Lus10028690 locus=Lus10028690.g ID=Lus10028690.BGIv1.0 annot-version=v1.0 ATGGAGAAGATGAGGAGCAAGTCGTTCCCACAGTACTCGCCGGCGTTCACCGATGGCGGCGACAACAAGACGTATAGCTTCAACGGGGAGAAGCCGGCAG GGGATCGGGAGACGAAGAGGAAGAAGAGGGTGGCGGCTTACAACGTGTTCACCGTCGAAGGGAAGCTCAAGTCCAGCTTTAGAAATGGGTTCAAATGGAT CAAAACCAAGTTCACTGCTATTGATTCTTCTGGCTATGGTCTTTGA
AA sequence Show only first row Show all	>Lus10028690 pacid=23164492 polypeptide=Lus10028690 locus=Lus10028690.g ID=Lus10028690.BGIv1.0 annot-version=v1.0 MEKMRSKSFPQYSPAFTDGGDNKTYSFNGEKPAGDRETKRKKRVAAYNVFTVEGKLKSSFRNGFKWIKTKFTAIDSSGYGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G09890			Protein of unknown function (D...		Lus10028690 [exp]	0	1
AT2G38280		ATAMPD, FAC1	EMBRYONIC FACTOR1, ADENOSINE 5...		Lus10002849 [exp]	6.6	0.6904
AT5G52450			MATE efflux family protein (.1...		Lus10017998 [exp]	23.7	0.6424
AT4G19510			Disease resistance protein (TI...		Lus10024149 [exp]	39.4	0.5908
AT1G05805	bHLH	bHLH128	basic helix-loop-helix (bHLH) ...		Lus10025518 [exp]	65.4	0.6043
AT1G73320			S-adenosyl-L-methionine-depend...		Lus10031894 [exp]	109.6	0.5628
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Lus10007044 [exp]	136.9	0.5609
AT3G51820		PDE325, ATG4, G...	PIGMENT DEFECTIVE 325, UbiA pr...		Lus10002850 [exp]	176.0	0.5405

Compare expression of checked genes

Lus10028690 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.