Lus10028700 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G08690 285 / 2e-100 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G56150 282 / 2e-99 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT1G64230 281 / 5e-99 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT5G53300 279 / 2e-98 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT4G27960 279 / 2e-98 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT5G41700 278 / 6e-98 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT2G16740 263 / 3e-92 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT3G08700 249 / 2e-86 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 170 / 9e-55 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G78870 149 / 4e-47 UBC35 ,UBC13A UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009422 308 / 6e-110 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10039323 284 / 4e-100 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 284 / 4e-100 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 283 / 1e-99 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 283 / 1e-99 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 281 / 4e-99 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10022726 280 / 1e-98 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014187 280 / 1e-98 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10033937 279 / 4e-98 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G471200 286 / 5e-101 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.011G168200 285 / 9e-101 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G094900 285 / 1e-100 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.012G033000 284 / 3e-100 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 284 / 3e-100 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.003G136200 283 / 9e-100 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 282 / 1e-99 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.016G138900 280 / 6e-99 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G131400 280 / 8e-99 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.019G083800 276 / 3e-97 AT5G56150 280 / 1e-98 ubiquitin-conjugating enzyme 30 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10028700 pacid=23164641 polypeptide=Lus10028700 locus=Lus10028700.g ID=Lus10028700.BGIv1.0 annot-version=v1.0
ATGGCTTCAAAGAGGATTAACAAGGAGCTCAAGGACTTGCAGAAGGATCCTCCTGCATCATGCAGTGCAGGACCTGCTGGTGATGATATGTTCCATTGGC
AAGCAACTATAATGGGTCCTCCAGATAGCCCTTATGCCGGTGGTGTTTTCTTGGTCACCATTAACTTCCCTCCAGATTATCCATTCAAGCCACCCAAGTG
CTCGTTCAAGACCAAAGTTTATCACCCGAACATCAACAGCAACGGAAGCATCTGCCTCGACATCCTCAAAGAACAGTGGAGTCCAGCTCTCACCGTATCG
AAGGTGCTGCTGTCTATTTGCTCGCTGCTGACGGACCCCAACCCGGACGATCCACTGGTGCCTGAGATTGCTCACATGTACAAGAACGACAGAACCAAGT
ATGAGAACACCGCTCGTGCCTGGACCCAGAAGTACGCAATGGGTTAA
AA sequence
>Lus10028700 pacid=23164641 polypeptide=Lus10028700 locus=Lus10028700.g ID=Lus10028700.BGIv1.0 annot-version=v1.0
MASKRINKELKDLQKDPPASCSAGPAGDDMFHWQATIMGPPDSPYAGGVFLVTINFPPDYPFKPPKCSFKTKVYHPNINSNGSICLDILKEQWSPALTVS
KVLLSICSLLTDPNPDDPLVPEIAHMYKNDRTKYENTARAWTQKYAMG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G08690 ATUBC11, UBC11 ubiquitin-conjugating enzyme 1... Lus10028700 0 1
AT5G03340 ATPase, AAA-type, CDC48 protei... Lus10023018 1.0 0.8996
AT2G31200 ADF6, ATADF6 actin depolymerizing factor 6 ... Lus10022933 2.4 0.8813
AT2G24940 ATMAPR2 membrane-associated progestero... Lus10002241 4.0 0.8509
AT5G11770 NADH-ubiquinone oxidoreductase... Lus10032157 4.9 0.8886
AT4G18700 ATWL4, CIPK12, ... SNF1-RELATED PROTEIN KINASE 3.... Lus10025397 6.5 0.8638
AT5G22060 ATJ2 ARABIDOPSIS THALIANA DNAJ HOMO... Lus10004109 8.9 0.8726
AT1G08700 PS1 Presenilin-1 (.1) Lus10020339 9.5 0.8555
AT2G43250 unknown protein Lus10040469 10.2 0.8237
AT3G08690 ATUBC11, UBC11 ubiquitin-conjugating enzyme 1... Lus10009422 11.1 0.8746
AT1G04635 EMB1687 EMBRYO DEFECTIVE 1687, ribonuc... Lus10032961 14.0 0.7736

Lus10028700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.