Lus10028701 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G09620 227 / 8e-76 Mitochondrial transcription termination factor family protein (.1)
AT2G44020 44 / 3e-05 Mitochondrial transcription termination factor family protein (.1)
AT4G02990 42 / 0.0002 RUG2, BSM RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009420 391 / 9e-141 AT4G09620 214 / 6e-71 Mitochondrial transcription termination factor family protein (.1)
Lus10004614 47 / 5e-06 AT2G44020 707 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10022321 44 / 6e-05 AT4G02990 540 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10014877 44 / 7e-05 AT4G02990 665 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10026571 43 / 8e-05 AT4G38160 252 / 4e-83 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Lus10004534 42 / 0.0001 AT2G44020 477 / 7e-168 Mitochondrial transcription termination factor family protein (.1)
Lus10029422 41 / 0.0003 AT2G36000 294 / 3e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10013854 40 / 0.0005 AT4G38160 446 / 2e-158 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Lus10004219 40 / 0.0005 AT2G36000 293 / 8e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G113500 259 / 2e-88 AT4G09620 244 / 1e-82 Mitochondrial transcription termination factor family protein (.1)
Potri.013G116700 48 / 2e-06 AT2G44020 764 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.014G137400 47 / 4e-06 AT4G02990 669 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Potri.001G029400 42 / 0.0001 AT5G07900 181 / 4e-53 Mitochondrial transcription termination factor family protein (.1)
Potri.004G209400 41 / 0.0002 AT4G38160 481 / 3e-172 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Potri.001G035200 40 / 0.0008 AT5G07900 168 / 3e-48 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10028701 pacid=23164520 polypeptide=Lus10028701 locus=Lus10028701.g ID=Lus10028701.BGIv1.0 annot-version=v1.0
ATGGTGGCAGGGATGGTAGGAAGAGCATTGGCTGCAGCACCTCTGCTAACCTTCAATTCCGGAACTCGATCGGGCTTTCTTGATCACGACCTTCAAACAA
CAACACCTCTAGTTCTAAGACCGAACCCGAGTCATCCCAGCAGATGGGCGGTAGATTCGACTGCAAAGTCCGAAACCTTACCCTTAAGCGACCAAGATCA
GACAACATGGGACTCGTGCAGAGAAGTCCTGTCAGCATTCGACTTCGACATGAACGAAAAGGACAAGATGCTAGGGAAAGCATTCGGCCACGTGGCATCC
CCATACTGGGGGGAAGACCGGAAGCAAGAAGTCCCTACGTACGAGGTCGTTAAAGGGATCGTGGACTTCCTGAAAGGCCTTGGCTTGACCGACGAGGATC
TGGTCAAGGTGCTGAAGAAGTTTCCAGAAGTCATGGGGTGTAGCCTCGAAGAGGATCTGAAGAAGAACGTGGGAATTCTCGAAAAGGAGTGGGGGATCAA
GGGGAAGACTCTGAGGAGCTTGCTGCTTCGGAATCCGAAGGTTTTGGGGTTCAATGTCGATTGCAAGGGCGATTGCATGGCGCAATGCACCCGCTGCTGG
GTTCGTTTCTGA
AA sequence
>Lus10028701 pacid=23164520 polypeptide=Lus10028701 locus=Lus10028701.g ID=Lus10028701.BGIv1.0 annot-version=v1.0
MVAGMVGRALAAAPLLTFNSGTRSGFLDHDLQTTTPLVLRPNPSHPSRWAVDSTAKSETLPLSDQDQTTWDSCREVLSAFDFDMNEKDKMLGKAFGHVAS
PYWGEDRKQEVPTYEVVKGIVDFLKGLGLTDEDLVKVLKKFPEVMGCSLEEDLKKNVGILEKEWGIKGKTLRSLLLRNPKVLGFNVDCKGDCMAQCTRCW
VRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G09620 Mitochondrial transcription te... Lus10028701 0 1
AT5G49940 ATCNFU2, NFU2 CHLOROPLAST-LOCALIZED NIFU-LIK... Lus10015481 2.0 0.8698
AT1G17180 ATGSTU25 glutathione S-transferase TAU ... Lus10019480 3.7 0.8636
AT1G70480 Domain of unknown function (DU... Lus10029147 9.4 0.8182
AT4G21860 MSRB2 methionine sulfoxide reductase... Lus10007105 10.0 0.7823
AT5G54855 Pollen Ole e 1 allergen and ex... Lus10001821 10.1 0.8248
AT4G32530 ATPase, F0/V0 complex, subunit... Lus10000694 10.2 0.8299
AT1G77290 Glutathione S-transferase fami... Lus10029723 17.0 0.8285
AT4G21860 MSRB2 methionine sulfoxide reductase... Lus10020486 19.4 0.8240
AT4G38225 unknown protein Lus10026560 19.9 0.8412
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Lus10023428 20.2 0.8169

Lus10028701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.