Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09720 341 / 4e-121 AtRABG3a RAB GTPase homolog G3A (.1.2.3.4) AT1G22740 333 / 4e-118 RAB75, RAB7, AtRABG3b RAB GTPase homolog G3B (.1) AT1G52280 293 / 3e-102 AtRABG3d RAB GTPase homolog G3D (.1) AT2G21880 291 / 3e-101 AtRab7A, AtRABG2 ARABIDOPSIS RAB GTPASE HOMOLOG G2, RAB GTPase homolog 7A (.1.2) AT3G16100 290 / 5e-101 AtRABG3c, AtRab7D RAB GTPase homolog G3C (.1) AT3G18820 290 / 7e-101 RAB71, AtRABG3f, AtRab7B RAB GTPase homolog G3F (.1) AT1G49300 282 / 9e-98 ATRAB7, ATRABG3E ARABIDOPSIS RAB GTPASE HOMOLOG G3E, ARABIDOPSIS RAB GTPASE HOMOLOG 7, RAB GTPase homolog G3E (.1.2) AT5G39620 219 / 3e-73 AtRABG1 RAB GTPase homolog G1 (.1) AT5G47960 122 / 8e-35 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT3G12160 120 / 3e-34 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006059 [exp] 386 / 3e-139 AT4G09720 323 / 4e-114 RAB GTPase homolog G3A (.1.2.3.4) Lus10035872 [exp] 294 / 2e-102 AT1G52280 397 / 4e-143 RAB GTPase homolog G3D (.1) Lus10040468 [exp] 290 / 1e-100 AT3G18820 403 / 2e-145 RAB GTPase homolog G3F (.1) Lus10042328 [exp] 284 / 2e-98 AT3G18820 367 / 3e-131 RAB GTPase homolog G3F (.1) Lus10023582 [exp] 281 / 1e-97 AT3G18820 330 / 4e-117 RAB GTPase homolog G3F (.1) Lus10025790 [exp] 169 / 2e-53 AT1G52280 257 / 5e-88 RAB GTPase homolog G3D (.1) Lus10023829 [exp] 124 / 4e-34 AT3G12160 377 / 5e-132 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10016284 [exp] 120 / 5e-34 AT3G12160 386 / 2e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10012032 [exp] 120 / 9e-34 AT3G12160 379 / 1e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G062400 [exp] 372 / 2e-133 AT4G09720 375 / 1e-134 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G198800 [exp] 364 / 4e-130 AT4G09720 370 / 2e-132 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G085300 [exp] 307 / 1e-107 AT4G09720 291 / 3e-101 RAB GTPase homolog G3A (.1.2.3.4) Potri.009G115000 [exp] 296 / 3e-103 AT3G18820 408 / 2e-147 RAB GTPase homolog G3F (.1) Potri.004G153400 [exp] 295 / 5e-103 AT3G18820 405 / 2e-146 RAB GTPase homolog G3F (.1) Potri.007G079700 [exp] 275 / 2e-95 AT4G09720 272 / 3e-94 RAB GTPase homolog G3A (.1.2.3.4) Potri.003G053400 [exp] 276 / 3e-95 AT1G52280 395 / 2e-142 RAB GTPase homolog G3D (.1) Potri.001G182900 [exp] 273 / 4e-94 AT3G16100 394 / 7e-142 RAB GTPase homolog G3C (.1) Potri.001G270100 [exp] 122 / 9e-35 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.014G049400 [exp] 120 / 2e-34 AT1G02130 390 / 2e-140 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10028719 pacid=23164456 polypeptide=Lus10028719 locus=Lus10028719.g ID=Lus10028719.BGIv1.0 annot-version=v1.0 ATGTCAGTCCGCCGCCGTACTTTGCTCAAGGTCATCGTCCTCGGTGACAGCGGATATGTGCACAACAAATTTAGCCAGCAGTATAAAGCTACGATTGGTG CGGATTTCGTGACCAAAGAACTGCAGATTGATGATAAGCTTGTCACTCTTCAAATATGGGACACGGCTGGGCAAGAAAGGTTCCAGAGTCTCGGGGTGGC ATTCTACAGAGGGGCAGACTGCTGTGTTCTGGTTTATGATGTTAACAGCATGCGATCGTTTGACAGTCTCGAAAATTGGCATGATGAATTCCTGAAGCAG GCAAACCCAGCAGATCCGAAATCATTCCCATTCATACTGCTCGGAAACAAGATCGATGTAGATGGTGGAAATAGCAGAGTGGTATCTGAAAAGAGAGCAA AGGATTGGTGTGCTTCGAAAGGAAACATCCCTTACTTTGAGACTTCGGCGAAAGAGGACTACAACGTCGACCCGGCATTTCTATGCATCGCGAAGGCTGC TTTGTCCAATGAGCACGAACAAGACATATACTTCCAGAGCATCCCAGATGCGGTCCCTGAAAGTGAGCAACGCGGTGGTTGCGCCTGCTGA
AA sequence Show only first row Show all	>Lus10028719 pacid=23164456 polypeptide=Lus10028719 locus=Lus10028719.g ID=Lus10028719.BGIv1.0 annot-version=v1.0 MSVRRRTLLKVIVLGDSGYVHNKFSQQYKATIGADFVTKELQIDDKLVTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMRSFDSLENWHDEFLKQ ANPADPKSFPFILLGNKIDVDGGNSRVVSEKRAKDWCASKGNIPYFETSAKEDYNVDPAFLCIAKAALSNEHEQDIYFQSIPDAVPESEQRGGCAC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G09720		AtRABG3a	RAB GTPase homolog G3A (.1.2.3...		Lus10028719 [exp]	0	1
AT1G19360		RRA3	reduced residual arabinose 3, ...		Lus10042340 [exp]	1.4	0.9346
					Lus10033509 [exp]	3.5	0.9212
AT4G33380			unknown protein		Lus10009765 [exp]	4.5	0.8910
AT1G26870	NAC	FEZ, ANAC009	FEZ, Arabidopsis NAC domain co...		Lus10036749 [exp]	5.3	0.9221
AT5G10720		CKI2, AHK5	CYTOKININ INDEPENDENT 2, histi...		Lus10000105 [exp]	11.4	0.8852
AT1G27660	bHLH	bHLH110	basic helix-loop-helix (bHLH) ...		Lus10025987 [exp]	11.5	0.9155
AT2G02061			Nucleotide-diphospho-sugar tra...		Lus10031330 [exp]	12.1	0.9085
AT3G14470			NB-ARC domain-containing disea...		Lus10022792 [exp]	12.2	0.9124
AT5G03150	C2H2ZnF	JKD	JACKDAW, C2H2-like zinc finger...		Lus10036116 [exp]	14.5	0.9114
AT5G26751		ATSK11 ,SK 11	ARABIDOPSIS THALIANA SHAGGY-RE...		Lus10001519 [exp]	14.8	0.9004

Compare expression of checked genes

Lus10028719 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.