Lus10028724 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G34220 382 / 7e-127 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT4G35730 251 / 5e-78 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G25420 234 / 2e-73 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT2G19710 202 / 2e-56 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G29440 184 / 4e-50 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G14830 113 / 6e-27 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G13340 110 / 2e-26 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G52315 102 / 6e-24 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G79910 99 / 3e-22 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT4G32350 92 / 2e-19 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006061 805 / 0 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10041836 238 / 5e-73 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10028383 232 / 1e-70 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10000978 230 / 6e-66 AT2G19710 308 / 6e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10040542 230 / 8e-66 AT2G19710 309 / 2e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041442 213 / 1e-65 AT1G25420 270 / 6e-90 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Lus10034330 177 / 3e-51 AT1G25420 218 / 3e-69 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Lus10041468 155 / 6e-42 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10034303 151 / 2e-40 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G117100 402 / 5e-135 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.019G087400 385 / 2e-128 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.008G121300 250 / 1e-79 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.007G059800 247 / 4e-76 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.006G149800 237 / 3e-68 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.010G127000 145 / 2e-38 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.017G113900 127 / 4e-33 AT1G13340 211 / 9e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.004G100900 129 / 7e-32 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.013G135700 128 / 1e-31 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.004G038600 122 / 9e-30 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Lus10028724 pacid=23164621 polypeptide=Lus10028724 locus=Lus10028724.g ID=Lus10028724.BGIv1.0 annot-version=v1.0
ATGTCGATGCTCGACGCCTTCTTCAGTAACAAAGGATTCAAAGCTGCCAAATGTAAAACCCTGCTGAAGCTGACGATACCGCGGATTAAGCTGCTGAGGA
ACAGGAGGGAGATTCAGATCAGGCAGATGCGTCGCGATATTGCCAAGCTTCTGGAGAATGGACAGGAAGCTACTGCTCGAATCCGAGTTGAACATATTGT
AAGAGAAGAGAACATGATGGCTGCTCAAGAAGTCCTTGAGCTCTTCTGTGAGCTTATTGCTGTACGCCTTCCAATCATCGAAGCACAAAGGGAATGTCCT
CTGGATTTGAAAGAAGCGATATCCAGTATCTGCTTTGCTGCACCAAGATGCGCCGACTTGCCAGAGTTGATCCAGGTCCAGATGATGTTTGCCTCCAAAT
ATGGAAAAGAGTTTGTCTCTGCTGCAACTGAACTTATGCCAGATTGTGGGGTTAATCGCCAGATAGTGGAGCTCCTATCAGTTCGTGCGCCTTCCCCGGA
TGTAAAACTGAAACTTCTCAAGGCAATTGCTGAGGAACATGAGTTGGACTGGGATCCGGCTGAGTCCGAAGCTGAACTTTTGAAACCGCATGAAGATTTA
TTGAACGGTCCATCGCAGTATGTCACTGAGTCGTCAAAGTTGCCTTTCCCGGATGAGAACAAAGATGAAGCTTTAAGCTCCGATCATGCAGGTGCTAGTC
ATGAGCTACCCGACACGGATTCCAGTGCCGATGAGCTAGACTTTCCCGATGTTCCCAAGCTCACAGTAAGGCCTAATCCAGCTGCTCCTTCTGCACCAGA
TACTTCAAATTCCGCCGGCACCCATGAGGTTATATTTGAAGAAATGCCAATGGCGTCGATATTGGCATTGAACAACAACGAAGGTCATGGTTCCCAGGAA
AAAAAGTTCTTGCCTTTCATCACTACTCCACAGGTTGCATCAGCATCTGCTTCGCCTACAAGAGAACACAGCTCATCACCGGAGCCTCGAAGTAAGCCCG
ACATTGATCTGCACGATATCTTGGTCTCGGCTCAGGCTGCTGCAGAGACTGCAGAGCGTGCAGCAGCAGCAGCCCGATCAGCTGCCACGATTGCCCAGGC
GAAGATCAAGGAGCTCTCCAAGATCAACAGCGACAAGTCGCTTGATCTCGAGGCCGACAATCCTTTCACTACCGAGATCGCGAACCAGCCTGACTTGGTG
GACAAGGTCCATCATCTCAGCCACCAACACTATTCCTTCAAATCTCCAGAGCCCTTCGAGAAAGACGGGATGGTATTTGACTCTCTGAGGGATGAGAGTG
TTCTGAGAAGAGAATCTCCTCGCCCGGAGATGCAACGGCTCACTTCCATCGACGAAGACCCTTACCTCTCATACCCCAACTTGTTTGCATCATCATCGTC
ACGCAACTCTAGATCGTCCCCTTGTTTCGATTCGGACCCACGATCTCCACATTAG
AA sequence
>Lus10028724 pacid=23164621 polypeptide=Lus10028724 locus=Lus10028724.g ID=Lus10028724.BGIv1.0 annot-version=v1.0
MSMLDAFFSNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIRQMRRDIAKLLENGQEATARIRVEHIVREENMMAAQEVLELFCELIAVRLPIIEAQRECP
LDLKEAISSICFAAPRCADLPELIQVQMMFASKYGKEFVSAATELMPDCGVNRQIVELLSVRAPSPDVKLKLLKAIAEEHELDWDPAESEAELLKPHEDL
LNGPSQYVTESSKLPFPDENKDEALSSDHAGASHELPDTDSSADELDFPDVPKLTVRPNPAAPSAPDTSNSAGTHEVIFEEMPMASILALNNNEGHGSQE
KKFLPFITTPQVASASASPTREHSSSPEPRSKPDIDLHDILVSAQAAAETAERAAAAARSAATIAQAKIKELSKINSDKSLDLEADNPFTTEIANQPDLV
DKVHHLSHQHYSFKSPEPFEKDGMVFDSLRDESVLRRESPRPEMQRLTSIDEDPYLSYPNLFASSSSRNSRSSPCFDSDPRSPH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G34220 Regulator of Vps4 activity in ... Lus10028724 0 1
AT2G17970 2-oxoglutarate (2OG) and Fe(II... Lus10028462 1.0 0.8797
AT1G34220 Regulator of Vps4 activity in ... Lus10006061 2.6 0.8652
AT4G30190 PMA2, AHA2 PLASMA MEMBRANE PROTON ATPASE ... Lus10007949 4.2 0.8764
AT3G27320 alpha/beta-Hydrolases superfam... Lus10037056 6.7 0.8450
AT5G65720 ATNIFS1, NIFS1 ... NITROGEN FIXATION S HOMOLOG 1,... Lus10011572 9.4 0.8675
AT4G25230 RIN2 RPM1 interacting protein 2 (.1... Lus10031728 9.5 0.8704
AT5G54540 Uncharacterised conserved prot... Lus10014803 11.3 0.8632
AT1G40087 Plant transposase (Ptta/En/Spm... Lus10021587 12.0 0.8356
AT1G79420 Protein of unknown function (D... Lus10001755 14.1 0.8671
AT4G25230 RIN2 RPM1 interacting protein 2 (.1... Lus10031152 14.4 0.8402

Lus10028724 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.