Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09890 69 / 6e-17 Protein of unknown function (DUF3511) (.1) AT5G11970 52 / 2e-10 Protein of unknown function (DUF3511) (.1) AT2G47480 52 / 3e-10 Protein of unknown function (DUF3511) (.1) AT2G19460 49 / 6e-09 Protein of unknown function (DUF3511) (.1) AT3G13910 49 / 6e-09 Protein of unknown function (DUF3511) (.1) AT1G72720 47 / 3e-08 Protein of unknown function (DUF3511) (.1) AT3G62640 46 / 6e-08 Protein of unknown function (DUF3511) (.1) AT3G05725 43 / 2e-06 Protein of unknown function (DUF3511) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028690 [exp] 130 / 2e-41 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10033529 [exp] 74 / 6e-19 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) Lus10020842 [exp] 71 / 3e-17 AT4G09890 69 / 2e-16 Protein of unknown function (DUF3511) (.1) Lus10005802 [exp] 62 / 4e-14 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10006799 [exp] 61 / 6e-14 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) Lus10027629 [exp] 58 / 2e-12 AT2G19460 110 / 2e-32 Protein of unknown function (DUF3511) (.1) Lus10011939 [exp] 58 / 3e-12 AT2G19460 109 / 6e-32 Protein of unknown function (DUF3511) (.1) Lus10017155 [exp] 50 / 5e-09 AT5G11970 93 / 1e-25 Protein of unknown function (DUF3511) (.1) Lus10021581 [exp] 49 / 7e-09 AT5G11970 97 / 4e-27 Protein of unknown function (DUF3511) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G065200 [exp] 72 / 3e-18 AT4G09890 84 / 9e-23 Protein of unknown function (DUF3511) (.1) Potri.005G195800 [exp] 72 / 5e-18 AT4G09890 81 / 1e-21 Protein of unknown function (DUF3511) (.1) Potri.007G077500 [exp] 65 / 2e-15 AT4G09890 80 / 3e-21 Protein of unknown function (DUF3511) (.1) Potri.010G140800 [exp] 51 / 5e-10 AT2G47480 62 / 2e-14 Protein of unknown function (DUF3511) (.1) Potri.001G197700 [exp] 50 / 4e-09 AT2G19460 78 / 1e-19 Protein of unknown function (DUF3511) (.1) Potri.014G123600 [exp] 49 / 5e-09 AT2G47480 93 / 5e-26 Protein of unknown function (DUF3511) (.1) Potri.006G225900 [exp] 47 / 4e-08 AT5G11970 90 / 2e-24 Protein of unknown function (DUF3511) (.1) Potri.006G147700 [exp] 47 / 5e-08 AT2G19460 96 / 2e-26 Protein of unknown function (DUF3511) (.1) Potri.005G019900 [exp] 45 / 2e-07 AT3G05725 63 / 3e-14 Protein of unknown function (DUF3511) (.1) Potri.003G043600 [exp] 44 / 7e-07 AT5G11970 89 / 5e-24 Protein of unknown function (DUF3511) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12023 [flax] [poplar] DUF3511 Domain of unknown function (DUF3511)
Representative CDS sequence Show only first row Show all	>Lus10028734 pacid=23164512 polypeptide=Lus10028734 locus=Lus10028734.g ID=Lus10028734.BGIv1.0 annot-version=v1.0 ATGGAGAAGATGAGGAGCAAGTCGTTCCCGCAGTACACGTCGGCGGCGTGCACCGACGGCAGCGAGAAGACATACAGCTTCAACGGGGAGAAGCCGGCAG GGGACAGGGAGGCGAAGAGGAAGAAGAGGGTGGCGGCGTACAACGTGTTCACCGTCGAAGGGAAGCTCAAGTCCAGCTTCAGAAATGGGTTCAAATGGTT CAAAACCAAGTTCACTACTGATCATGATTCTTCTTCTGGCTATGGTATTTGA
AA sequence Show only first row Show all	>Lus10028734 pacid=23164512 polypeptide=Lus10028734 locus=Lus10028734.g ID=Lus10028734.BGIv1.0 annot-version=v1.0 MEKMRSKSFPQYTSAACTDGSEKTYSFNGEKPAGDREAKRKKRVAAYNVFTVEGKLKSSFRNGFKWFKTKFTTDHDSSSGYGI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G09890			Protein of unknown function (D...		Lus10028734 [exp]	0	1
AT3G23150		ETR2	ethylene response 2, Signal tr...		Lus10022203 [exp]	1.4	0.9346
AT5G01210			HXXXD-type acyl-transferase fa...		Lus10027779 [exp]	4.9	0.9221
					Lus10041251 [exp]	6.6	0.9341
AT3G25590			unknown protein		Lus10034409 [exp]	6.9	0.9313
AT5G58375			Methyltransferase-related prot...		Lus10008585 [exp]	7.7	0.9192
AT3G54450			Major facilitator superfamily ...		Lus10039521 [exp]	10.4	0.9328
AT2G37870			Bifunctional inhibitor/lipid-t...		Lus10031925 [exp]	13.5	0.9245
AT4G24910			Protein of unknown function (D...		Lus10002345 [exp]	14.8	0.9290
AT5G48150	GRAS	PAT1	phytochrome a signal transduct...		Lus10006369 [exp]	15.7	0.8744
AT4G39980		DHS1	3-deoxy-D-arabino-heptulosonat...		Lus10025739 [exp]	17.1	0.9290

Compare expression of checked genes

Lus10028734 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.