Lus10028749 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64160 214 / 4e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G23690 204 / 3e-67 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11190 167 / 6e-53 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11180 167 / 7e-53 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11210 167 / 1e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 71 / 5e-15 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 69 / 2e-14 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 68 / 3e-14 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21100 63 / 2e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 62 / 5e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017539 301 / 2e-105 AT1G64160 238 / 9e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017538 175 / 1e-55 AT4G23690 187 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10032331 169 / 2e-53 AT4G23690 187 / 5e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10024715 168 / 6e-53 AT4G23690 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10024714 167 / 1e-52 AT4G23690 186 / 3e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 73 / 2e-15 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 69 / 3e-14 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 65 / 5e-13 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 65 / 6e-13 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G142401 231 / 6e-78 AT1G64160 223 / 3e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096560 231 / 6e-78 AT1G64160 223 / 3e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134800 174 / 5e-55 AT1G64160 188 / 4e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142501 172 / 1e-54 AT1G64160 179 / 1e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096680 172 / 2e-54 AT1G64160 178 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142702 171 / 2e-54 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G097001 171 / 2e-54 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134600 169 / 2e-53 AT1G64160 182 / 5e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096800 169 / 2e-53 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142602 169 / 2e-53 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10028749 pacid=23177319 polypeptide=Lus10028749 locus=Lus10028749.g ID=Lus10028749.BGIv1.0 annot-version=v1.0
ATGAAGCATTCTTCTTCTCATTCTTCATCTTGCCTTCCTTTTTTGTTAACAACAACCACCCCCATCTTCCTCCTCCTCCTCTCACTGATCTGTCCAGCTG
CTGCCACGTGGCGGACGCCAACTCACCACCAGCATGGAAGAAATCCCAATAAGCCATGCAAGCAGCTGGTCCTCTACTACCACGACATCCTCTTCCATGG
GAACGGCGACCAAGGGAACGCCACGTCAGCAGCGGCCGCCAACGCCACCAAGCTGGGAGACTACAAGTTCGGGATGCTGGTGGTGTTCGACGACCCCGTG
ACGAAAGACGGGCACCTGAAGTCGAAGGCGGTGGCGCGTGCACAAGGGTTCTACTTCTACGACATGAAGAGCACGTACAACGCGTGGTTCGCCTACACGC
TGGTGTTCAACTCGACGGAGCACAAGGGGACCATCAACATCATGGGAGCCGACATGATGTCGGAGAAGACCAGGGACCTCTCCGTCGTCGGGGGGACCGG
GGATTTCTTCATGGCGCGTGGGATCGCGACTTTCCGTACGGACACTTTCCAGGGCGATAACTACTTCCGGTTGGAGATGGATATTAAGTTGTACGACTGT
TATAAGTACTAG
AA sequence
>Lus10028749 pacid=23177319 polypeptide=Lus10028749 locus=Lus10028749.g ID=Lus10028749.BGIv1.0 annot-version=v1.0
MKHSSSHSSSCLPFLLTTTTPIFLLLLSLICPAAATWRTPTHHQHGRNPNKPCKQLVLYYHDILFHGNGDQGNATSAAAANATKLGDYKFGMLVVFDDPV
TKDGHLKSKAVARAQGFYFYDMKSTYNAWFAYTLVFNSTEHKGTINIMGADMMSEKTRDLSVVGGTGDFFMARGIATFRTDTFQGDNYFRLEMDIKLYDC
YKY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64160 Disease resistance-responsive ... Lus10028749 0 1
AT1G30840 ATPUP4 purine permease 4 (.1.2) Lus10002868 2.8 0.6749
Lus10023538 3.9 0.6736
AT4G35150 O-methyltransferase family pro... Lus10012408 6.8 0.6889
AT3G04950 unknown protein Lus10022395 7.2 0.6180
Lus10024679 12.7 0.6391
AT2G32030 Acyl-CoA N-acyltransferases (N... Lus10032323 14.3 0.6416
AT3G07610 IBM1 increase in bonsai methylation... Lus10004602 18.0 0.5881
Lus10011637 19.1 0.6449
AT1G60630 Leucine-rich repeat protein ki... Lus10019429 24.4 0.6287
AT1G52190 Major facilitator superfamily ... Lus10008539 27.9 0.6226

Lus10028749 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.