Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23690 52 / 3e-09 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G64160 49 / 3e-08 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G11190 49 / 4e-08 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G11210 42 / 2e-05 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017538 [exp] 95 / 2e-25 AT4G23690 187 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10024715 [exp] 64 / 1e-13 AT4G23690 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10032331 [exp] 63 / 2e-13 AT4G23690 187 / 5e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10024714 [exp] 62 / 5e-13 AT4G23690 186 / 3e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G142702 [exp] 82 / 1e-20 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G097001 [exp] 82 / 1e-20 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G096800 [exp] 78 / 3e-19 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.013G142602 [exp] 78 / 3e-19 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G096680 [exp] 78 / 3e-19 AT1G64160 178 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.013G142501 [exp] 78 / 3e-19 AT1G64160 179 / 1e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G134600 [exp] 76 / 3e-18 AT1G64160 182 / 5e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G134400 [exp] 74 / 2e-17 AT1G64160 184 / 1e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G134800 [exp] 62 / 6e-13 AT1G64160 188 / 4e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G096440 [exp] 52 / 1e-09 AT1G64160 119 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028750 pacid=23177143 polypeptide=Lus10028750 locus=Lus10028750.g ID=Lus10028750.BGIv1.0 annot-version=v1.0 ATGGACACCAAACCACCATCACCAACTCTATTAGCTCACGACCACCTTCCAAAGCCACGACCAAAACCATGCAAGGAACTAGTCTTCTACTTCCACGGCA TCATCTACAACGGCAACAACTACAGGAACGCCACGGCAGCCATCGTGGGGTTCCCCGGCTTGGGGGGACAAGACCGCCTTGGCGGGACCAAACCACTTCG GCGACCTGGTCGTGTTCGACGACCCTATAACACTGGACAGAAATTGCACTCCCCGACGGTGGGACGCGCCCATGGGATGTATGTGTACGGCGGGAATGAT GCGTTCACAGCGTGA
AA sequence Show only first row Show all	>Lus10028750 pacid=23177143 polypeptide=Lus10028750 locus=Lus10028750.g ID=Lus10028750.BGIv1.0 annot-version=v1.0 MDTKPPSPTLLAHDHLPKPRPKPCKELVFYFHGIIYNGNNYRNATAAIVGFPGLGGQDRLGGTKPLRRPGRVRRPYNTGQKLHSPTVGRAHGMYVYGGND AFTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23690			Disease resistance-responsive ...		Lus10028750 [exp]	0	1
AT2G22180			hydroxyproline-rich glycoprote...		Lus10019667 [exp]	4.0	0.7416
AT4G38080			hydroxyproline-rich glycoprote...		Lus10029845 [exp]	6.3	0.6554
AT1G26730			EXS (ERD1/XPR1/SYG1) family pr...		Lus10004284 [exp]	10.1	0.6529
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10013919 [exp]	12.6	0.6486
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013920 [exp]	14.5	0.6375
AT2G15220			Plant basic secretory protein ...		Lus10019805 [exp]	14.5	0.6278
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10014126 [exp]	15.9	0.6375
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10002612 [exp]	17.0	0.6300
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10015241 [exp]	17.1	0.6375
AT5G20260			Exostosin family protein (.1)		Lus10039980 [exp]	18.3	0.6375

Compare expression of checked genes

Lus10028750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.