Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01480 49 / 2e-08 AT-ACC2, ACS2 1-amino-cyclopropane-1-carboxylate synthase 2 (.1.2) AT4G11280 46 / 2e-07 ATACS6, ACS6 1-aminocyclopropane-1-carboxylic acid (acc) synthase 6 (.1) AT3G61510 41 / 1e-05 AT-ACS1, ACS1 ARABIDOPSIS THALIANA 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 1, ACC synthase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017521 [exp] 130 / 8e-38 AT4G11280 643 / 0.0 1-aminocyclopropane-1-carboxylic acid (acc) synthase 6 (.1) Lus10024673 [exp] 72 / 2e-16 AT1G01480 610 / 0.0 1-amino-cyclopropane-1-carboxylate synthase 2 (.1.2) Lus10032301 [exp] 70 / 1e-15 AT1G01480 609 / 0.0 1-amino-cyclopropane-1-carboxylate synthase 2 (.1.2) Lus10036396 [exp] 54 / 5e-10 AT3G61510 660 / 0.0 ARABIDOPSIS THALIANA 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 1, ACC synthase 1 (.1) Lus10007910 [exp] 52 / 1e-09 AT3G61510 659 / 0.0 ARABIDOPSIS THALIANA 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 1, ACC synthase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G132300 [exp] 86 / 2e-21 AT4G11280 659 / 0.0 1-aminocyclopropane-1-carboxylic acid (acc) synthase 6 (.1) Potri.001G099400 [exp] 81 / 8e-20 AT4G11280 656 / 0.0 1-aminocyclopropane-1-carboxylic acid (acc) synthase 6 (.1) Potri.002G163700 [exp] 65 / 4e-14 AT3G61510 684 / 0.0 ARABIDOPSIS THALIANA 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 1, ACC synthase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028761 pacid=23177303 polypeptide=Lus10028761 locus=Lus10028761.g ID=Lus10028761.BGIv1.0 annot-version=v1.0 ATGGACGACGAGACGATGGAGGTGGCGCTGTCAAGGATTAGGACTTTTGTGGCGGAGAACAAGGAGGCGATGAAGCCGGTGAAGAAGCTATGCGCTCAGA GCAGCTTGAAATTGAGCTTCTCGAACAGGATCTACGACGAGTTTATTATGTCCCCGAGGTCGCCGATTGCTCAGTCGCCGCTCGTCCGGGCCAGAACTTG A
AA sequence Show only first row Show all	>Lus10028761 pacid=23177303 polypeptide=Lus10028761 locus=Lus10028761.g ID=Lus10028761.BGIv1.0 annot-version=v1.0 MDDETMEVALSRIRTFVAENKEAMKPVKKLCAQSSLKLSFSNRIYDEFIMSPRSPIAQSPLVRART

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G11280		ATACS6, ACS6	1-aminocyclopropane-1-carboxyl...		Lus10028761 [exp]	0	1
AT4G11280		ATACS6, ACS6	1-aminocyclopropane-1-carboxyl...		Lus10028760 [exp]	1.0	0.8730
AT5G58320			Kinase interacting (KIP1-like)...		Lus10034448 [exp]	1.7	0.8090
AT3G23160			Protein of unknown function (D...		Lus10021210 [exp]	6.2	0.7292
AT2G39010		PIP2E, PIP2;6	PLASMA MEMBRANE INTRINSIC PROT...		Lus10021475 [exp]	6.8	0.8153
AT1G11190		ENDO1, BFN1	ENDONUCLEASE 1, bifunctional n...		Lus10018452 [exp]	8.1	0.7857
AT3G11660		NHL1	NDR1/HIN1-like 1 (.1)		Lus10004202 [exp]	13.6	0.8070
AT4G24240	WRKY	ATWRKY7, WRKY7	WRKY DNA-binding protein 7 (.1...		Lus10010053 [exp]	14.4	0.7448
AT3G10120			unknown protein		Lus10021358 [exp]	16.3	0.7510
AT4G00430		PIP1;4, TMP-C, ...	TRANSMEMBRANE PROTEIN C, PLASM...		Lus10022577 [exp]	20.0	0.7713
AT2G38320		TBL34	TRICHOME BIREFRINGENCE-LIKE 34...		Lus10022676 [exp]	21.7	0.7489

Compare expression of checked genes

Lus10028761 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.