Lus10028762 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
AT5G52740 57 / 2e-11 Copper transport protein family (.1)
AT5G23760 51 / 3e-09 Copper transport protein family (.1)
AT3G05920 49 / 3e-08 Heavy metal transport/detoxification superfamily protein (.1)
AT5G26690 45 / 5e-07 Heavy metal transport/detoxification superfamily protein (.1)
AT5G52750 45 / 9e-07 Heavy metal transport/detoxification superfamily protein (.1)
AT5G52770 43 / 5e-06 Copper transport protein family (.1)
AT1G63950 42 / 1e-05 Heavy metal transport/detoxification superfamily protein (.1)
AT5G52730 42 / 2e-05 Copper transport protein family (.1)
AT5G27690 40 / 0.0003 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017520 175 / 1e-57 AT1G01490 52 / 3e-09 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10014967 81 / 7e-20 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027524 82 / 3e-19 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10039286 77 / 2e-17 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10036395 75 / 2e-17 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10007911 74 / 8e-17 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027523 69 / 1e-15 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10024672 68 / 3e-15 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10007455 69 / 3e-14 AT3G44480 98 / 1e-20 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G073000 128 / 5e-39 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.001G099500 112 / 5e-33 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.004G073100 99 / 2e-27 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147500 93 / 4e-25 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147400 92 / 6e-25 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147200 90 / 6e-24 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.003G132200 89 / 2e-23 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147000 85 / 5e-22 AT1G01490 61 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.014G089700 83 / 1e-20 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.002G163400 77 / 3e-18 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Lus10028762 pacid=23177214 polypeptide=Lus10028762 locus=Lus10028762.g ID=Lus10028762.BGIv1.0 annot-version=v1.0
ATGAAGAAAGTTGTTATAAAGGTAGATATACAAGACGGCAAGGGCAAGAGGAAGGTGATGAAGGCGGTTGCAGCGCTTTCAAGCATCGATTCGATTACAA
TCGACTTGAAGGATCAGAAGCTCACGGTGATCGGAGCTGTGGATCCGATCCACCTCATGTCGAAGCTGAAGAAGTGCTGCACCTCCGAGCTCTTGACCGT
GGGACCGGCGCCCAAGGCGGAGGAGAAGAAAGACGACAAGAAGAAAGAGGATCAAGGGAAGAAAGAAGACGAGAAGAAGAAATCAGATCCGGCTATGGAG
CAGCGCCATATTCAGGAGCTCGTGAATTCTTACAGATCTTACAATCCCTACATGACTCAGTATTACCATGTGGTCAGCGCTGAAGAAAACCCCAACAGTT
GCATCGTTTCCTGA
AA sequence
>Lus10028762 pacid=23177214 polypeptide=Lus10028762 locus=Lus10028762.g ID=Lus10028762.BGIv1.0 annot-version=v1.0
MKKVVIKVDIQDGKGKRKVMKAVAALSSIDSITIDLKDQKLTVIGAVDPIHLMSKLKKCCTSELLTVGPAPKAEEKKDDKKKEDQGKKEDEKKKSDPAME
QRHIQELVNSYRSYNPYMTQYYHVVSAEENPNSCIVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01490 Heavy metal transport/detoxifi... Lus10028762 0 1
AT1G01490 Heavy metal transport/detoxifi... Lus10017520 3.2 0.9375
AT2G38640 Protein of unknown function (D... Lus10010681 4.5 0.9252
AT5G05340 Peroxidase superfamily protein... Lus10034207 4.5 0.9327
AT1G32100 ATPRR1 pinoresinol reductase 1 (.1) Lus10012145 7.8 0.8877
AT5G38200 Class I glutamine amidotransfe... Lus10028493 10.2 0.9310
AT3G51520 diacylglycerol acyltransferase... Lus10013796 11.3 0.8870
AT5G18150 Methyltransferase-related prot... Lus10020287 14.1 0.9158
AT2G10950 BSD domain-containing protein ... Lus10039982 14.3 0.9291
AT4G27290 S-locus lectin protein kinase ... Lus10038553 17.5 0.9142
AT3G15760 unknown protein Lus10030098 19.6 0.9173

Lus10028762 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.