Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23250 114 / 8e-33 Succinyl-CoA ligase, alpha subunit (.1.2) AT5G08300 112 / 8e-32 Succinyl-CoA ligase, alpha subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003877 [exp] 120 / 4e-36 AT5G23250 198 / 6e-63 Succinyl-CoA ligase, alpha subunit (.1.2) Lus10017389 [exp] 118 / 4e-34 AT5G08300 588 / 0.0 Succinyl-CoA ligase, alpha subunit (.1) Lus10010187 [exp] 118 / 6e-34 AT5G08300 588 / 0.0 Succinyl-CoA ligase, alpha subunit (.1) Lus10010185 [exp] 114 / 2e-33 AT5G08300 377 / 1e-132 Succinyl-CoA ligase, alpha subunit (.1) Lus10040992 [exp] 113 / 4e-32 AT5G08300 591 / 0.0 Succinyl-CoA ligase, alpha subunit (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G036200 [exp] 115 / 3e-33 AT5G23250 496 / 6e-178 Succinyl-CoA ligase, alpha subunit (.1.2) Potri.015G028200 [exp] 112 / 4e-32 AT5G23250 507 / 0.0 Succinyl-CoA ligase, alpha subunit (.1.2) Potri.005G091400 [exp] 110 / 2e-31 AT5G23250 515 / 0.0 Succinyl-CoA ligase, alpha subunit (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028767 pacid=23177282 polypeptide=Lus10028767 locus=Lus10028767.g ID=Lus10028767.BGIv1.0 annot-version=v1.0 ATGGTCAGTGTGAAGGCTGCCCTGAACCAGCAATCGAAAACAAGATTAATTGGTCCGAATTGCCCTGGGATCATCAAACCAGAGGAATGCAAGATCGGAA TCATGCCTGGATACATCCACAAACCAGGGCGTATTGGAATTGTTTCACGGTCTGGCACAGTGACTTATGAGGCTGTGAGTGCTGATTCTTGA
AA sequence Show only first row Show all	>Lus10028767 pacid=23177282 polypeptide=Lus10028767 locus=Lus10028767.g ID=Lus10028767.BGIv1.0 annot-version=v1.0 MVSVKAALNQQSKTRLIGPNCPGIIKPEECKIGIMPGYIHKPGRIGIVSRSGTVTYEAVSADS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G23250			Succinyl-CoA ligase, alpha sub...		Lus10028767 [exp]	0	1
AT3G08840			D-alanine--D-alanine ligase fa...		Lus10012211 [exp]	8.4	0.8822
AT2G44180		MAP2A	methionine aminopeptidase 2A (...		Lus10000403 [exp]	9.0	0.8880
AT5G26610			D111/G-patch domain-containing...		Lus10001513 [exp]	9.9	0.8766
AT2G45990			unknown protein		Lus10036369 [exp]	12.2	0.8659
AT3G11290			unknown protein		Lus10002039 [exp]	16.9	0.8621
AT3G13970		APG12B, APG12	AUTOPHAGY 12 B, AUTOPHAGY 12, ...		Lus10000432 [exp]	19.8	0.8525
AT2G42940	AT-hook		Predicted AT-hook DNA-binding ...		Lus10031458 [exp]	20.4	0.8193
					Lus10040920 [exp]	20.6	0.8485
AT4G02715			unknown protein		Lus10014679 [exp]	24.2	0.8387
AT1G33780			Protein of unknown function (D...		Lus10009463 [exp]	31.9	0.8549

Compare expression of checked genes

Lus10028767 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.