Lus10028768 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G41460 64 / 5e-13 Protein of unknown function (DUF604) (.1)
AT4G23490 54 / 2e-09 Protein of unknown function (DUF604) (.1)
AT4G11350 48 / 2e-07 Protein of unknown function (DUF604) (.1), Protein of unknown function (DUF604) (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017514 180 / 2e-55 AT5G41460 759 / 0.0 Protein of unknown function (DUF604) (.1)
Lus10024663 81 / 2e-19 AT5G41460 280 / 2e-94 Protein of unknown function (DUF604) (.1)
Lus10032293 80 / 1e-18 AT4G23490 740 / 0.0 Protein of unknown function (DUF604) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G100700 97 / 9e-25 AT4G23490 757 / 0.0 Protein of unknown function (DUF604) (.1)
Potri.003G131400 94 / 2e-23 AT5G41460 732 / 0.0 Protein of unknown function (DUF604) (.1)
PFAM info
Representative CDS sequence
>Lus10028768 pacid=23177158 polypeptide=Lus10028768 locus=Lus10028768.g ID=Lus10028768.BGIv1.0 annot-version=v1.0
ATGAAAGGGAGCCAGAAAGATCCGGAGAAGATCATCTGGGATCAGATGCGGAGCCCTTCACACCCCAATTCCATCTCCGGTCCGGGTTCCCAAGCTCGGC
TCCTCCCCAAGCTCATGGCCTCCCTCTTGCTCTTCGTCACCATCACCTACGTTTTCTACACTTTGAAGCTCGTCTCCACTTCCTGCAACCACGAGCCCTT
CTCCTCCTCCACCCGCCACCTCTCCCTCGCCACCAACAACCACTCCGACATCGCTACTACGGAAGTCTCTCTCTCCCGCCTCTCTCGCCCGCCGCCGCGA
GATAGAGGAGACGTCGTCGTCGACGACGACAACGTCATCTTCTAA
AA sequence
>Lus10028768 pacid=23177158 polypeptide=Lus10028768 locus=Lus10028768.g ID=Lus10028768.BGIv1.0 annot-version=v1.0
MKGSQKDPEKIIWDQMRSPSHPNSISGPGSQARLLPKLMASLLLFVTITYVFYTLKLVSTSCNHEPFSSSTRHLSLATNNHSDIATTEVSLSRLSRPPPR
DRGDVVVDDDNVIF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G41460 Protein of unknown function (D... Lus10028768 0 1
AT4G23490 Protein of unknown function (D... Lus10028769 1.0 0.9358
AT2G02955 MEE12 maternal effect embryo arrest ... Lus10030476 2.8 0.8646
AT5G46290 KAS1, KAS I, KA... KETOACYL-ACP SYNTHASE 1, 3-ket... Lus10004934 4.6 0.8798
AT3G16290 EMB2083 embryo defective 2083, AAA-typ... Lus10037574 5.7 0.8733
AT5G40250 RING/U-box superfamily protein... Lus10023205 6.9 0.8450
AT2G44640 unknown protein Lus10043347 8.8 0.8827
AT1G68560 AXY3, TRG1, XYL... thermoinhibition resistant ger... Lus10034315 10.1 0.8694
AT3G51740 IMK2 inflorescence meristem recepto... Lus10002854 13.2 0.8704
AT5G62170 unknown protein Lus10027403 13.5 0.8443
AT1G78270 ATUGT85A4 UDP-glucosyl transferase 85A4 ... Lus10036969 13.9 0.8127

Lus10028768 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.