Lus10028773 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61460 154 / 4e-48 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT1G63840 127 / 1e-37 RING/U-box superfamily protein (.1)
AT5G41400 111 / 2e-31 RING/U-box superfamily protein (.1)
AT4G11360 97 / 5e-26 RHA1B RING-H2 finger A1B (.1)
AT4G11370 97 / 5e-26 RHA1A RING-H2 finger A1A (.1)
AT4G00305 87 / 2e-22 RING/U-box superfamily protein (.1)
AT3G43430 80 / 3e-19 RING/U-box superfamily protein (.1)
AT5G20885 76 / 8e-18 RING/U-box superfamily protein (.1)
AT2G04240 66 / 8e-14 XERICO RING/U-box superfamily protein (.1.2)
AT1G23980 68 / 1e-13 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017510 281 / 4e-98 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1)
Lus10032290 214 / 7e-72 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10024657 210 / 3e-70 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10036378 127 / 2e-37 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1)
Lus10008283 70 / 3e-15 AT3G61460 77 / 5e-18 brassinosteroid-responsive RING-H2 (.1)
Lus10029178 70 / 2e-14 AT5G40250 297 / 1e-98 RING/U-box superfamily protein (.1)
Lus10043353 68 / 2e-14 AT5G20885 157 / 4e-49 RING/U-box superfamily protein (.1)
Lus10019507 67 / 3e-14 AT5G20885 162 / 5e-51 RING/U-box superfamily protein (.1)
Lus10012987 68 / 8e-14 AT5G40250 302 / 7e-101 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G101000 198 / 1e-65 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1)
Potri.003G130900 188 / 8e-62 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1)
Potri.014G087700 143 / 4e-44 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1)
Potri.002G161900 142 / 9e-44 AT3G61460 234 / 7e-80 brassinosteroid-responsive RING-H2 (.1)
Potri.007G086300 73 / 1e-16 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.006G217000 71 / 6e-16 AT5G20885 138 / 8e-42 RING/U-box superfamily protein (.1)
Potri.011G150800 71 / 8e-16 AT3G61460 69 / 1e-14 brassinosteroid-responsive RING-H2 (.1)
Potri.007G086200 70 / 3e-15 AT1G15100 74 / 5e-17 RING-H2 finger A2A (.1)
Potri.014G170400 68 / 8e-15 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2)
Potri.009G170460 67 / 1e-14 AT4G38140 85 / 9e-22 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10028773 pacid=23177300 polypeptide=Lus10028773 locus=Lus10028773.g ID=Lus10028773.BGIv1.0 annot-version=v1.0
ATGGGGTTTCCGGCCACGGAGCTGCTGCTTCTTCCCAAGCTCCTAATCCATGCGCTCTCCCTCCTCTTCATTTTCCAGCGGATAATCACCTTGCTCTTCC
GCTACCTAGGCCTCCCTAATTTCTTAAATCCCAACTCCTCCGCCGATCAAGTCTCCAATTCGCCTGCAGTGAGTTATCCGGAGTTCCAGCGATCCATGTC
GGCGATCCTCATCCGCGAGATCCTCCCCGTGGTGAAGTTCGCCGACCTAATCGACCCGCCGGAGAGCTGCGCGGTGTGCCTGTACGAGTTCGAAGATGAG
GATGAGATCAGGATTCTGGCGAATTGCAAGCACGTTTTCCACAAGGAGTGCCTGGACAGGTGGGTGGGGTATGAGCGGAGAACGTGCCCTATGTGCCGGA
CGGCGGTGATTCCGGAGGATATGCAGGAGAGCTTCAACGATAAGTTCTGGGCGGCTTCTGGGATCCCTGATTTTTACGGGGAGTTGTCGCCAATTTCTGG
ATAG
AA sequence
>Lus10028773 pacid=23177300 polypeptide=Lus10028773 locus=Lus10028773.g ID=Lus10028773.BGIv1.0 annot-version=v1.0
MGFPATELLLLPKLLIHALSLLFIFQRIITLLFRYLGLPNFLNPNSSADQVSNSPAVSYPEFQRSMSAILIREILPVVKFADLIDPPESCAVCLYEFEDE
DEIRILANCKHVFHKECLDRWVGYERRTCPMCRTAVIPEDMQESFNDKFWAASGIPDFYGELSPISG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G61460 BRH1 brassinosteroid-responsive RIN... Lus10028773 0 1
AT4G16480 ATINT4 inositol transporter 4 (.1) Lus10010501 3.3 0.7710
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10000190 6.5 0.7599
Lus10024618 8.3 0.7299
AT1G63990 SPO11-2 sporulation 11-2 (.1) Lus10024675 9.2 0.7188
AT3G51070 S-adenosyl-L-methionine-depend... Lus10025976 9.9 0.6882
AT4G13230 Late embryogenesis abundant pr... Lus10022822 12.0 0.7053
Lus10010697 13.2 0.7053
AT5G20610 unknown protein Lus10025003 14.2 0.7053
Lus10008327 15.2 0.7053
AT5G64700 nodulin MtN21 /EamA-like trans... Lus10020867 15.5 0.6980

Lus10028773 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.