Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56670 74 / 1e-19 Ribosomal protein S30 family protein (.1) AT4G29390 74 / 1e-19 Ribosomal protein S30 family protein (.1) AT2G19750 74 / 1e-19 Ribosomal protein S30 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002508 [exp] 99 / 2e-29 AT4G29390 98 / 4e-29 Ribosomal protein S30 family protein (.1) Lus10017473 [exp] 99 / 2e-29 AT5G56670 98 / 4e-29 Ribosomal protein S30 family protein (.1) Lus10019054 [exp] 68 / 1e-15 AT5G56670 48 / 1e-07 Ribosomal protein S30 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G086600 [exp] 77 / 1e-20 AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1) Potri.015G084700 [exp] 77 / 1e-20 AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1) Potri.014G147200 [exp] 77 / 1e-20 AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04758 [flax] [poplar] Ribosomal_S30 Ribosomal protein S30
Representative CDS sequence Show only first row Show all	>Lus10028808 pacid=23177220 polypeptide=Lus10028808 locus=Lus10028808.g ID=Lus10028808.BGIv1.0 annot-version=v1.0 ATGGGTAAGGTGCACGGTTCTTTGGCTCGTGCTGGTAAGGTGAGGGGACAGACTCCCAAGGTCGCGAAGCAGGAGAAGAAGAAGAGGCCACGCGGCCGTG CTCACAAGAGGGAACAATACAACCGCAGATTCGTCACTGCTGTTGCAGGGACACTAGATCTTTGTTGCGCAGTCGATTGCTTGTCTATTAAATAG
AA sequence Show only first row Show all	>Lus10028808 pacid=23177220 polypeptide=Lus10028808 locus=Lus10028808.g ID=Lus10028808.BGIv1.0 annot-version=v1.0 MGKVHGSLARAGKVRGQTPKVAKQEKKKRPRGRAHKREQYNRRFVTAVAGTLDLCCAVDCLSIK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G56670			Ribosomal protein S30 family p...		Lus10028808 [exp]	0	1
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10023908 [exp]	2.8	0.8692
AT5G02610			Ribosomal L29 family protein ...		Lus10019180 [exp]	4.2	0.8273
AT2G34160			Alba DNA/RNA-binding protein (...		Lus10002027 [exp]	4.2	0.8811
AT5G21060			Glyceraldehyde-3-phosphate deh...		Lus10034077 [exp]	5.0	0.7975
AT1G08780		PFD4, PDF4, AIP...	PREFOLDIN 4, ABI3-interacting ...		Lus10021994 [exp]	5.5	0.8401
AT3G23390			Zinc-binding ribosomal protein...		Lus10013436 [exp]	7.1	0.8617
AT3G14080			Small nuclear ribonucleoprotei...		Lus10008124 [exp]	7.1	0.8411
AT5G08630			DDT domain-containing protein ...		Lus10029550 [exp]	7.7	0.8228
AT3G23390			Zinc-binding ribosomal protein...		Lus10040983 [exp]	11.3	0.8468
AT5G05670			signal recognition particle bi...		Lus10013031 [exp]	17.1	0.8307

Compare expression of checked genes

Lus10028808 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.