Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49400 145 / 8e-47 EMB1129 embryo defective 1129, Nucleic acid-binding, OB-fold-like protein (.1) AT3G18880 144 / 3e-46 Nucleic acid-binding, OB-fold-like protein (.1) AT1G79850 56 / 4e-11 PDE347, CS17, PRPS17, ORE4, RPS17 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1) AT4G30800 40 / 4e-05 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017467 [exp] 159 / 3e-52 AT3G18880 154 / 2e-50 Nucleic acid-binding, OB-fold-like protein (.1) Lus10017993 [exp] 156 / 3e-51 AT3G18880 159 / 3e-52 Nucleic acid-binding, OB-fold-like protein (.1) Lus10035863 [exp] 52 / 2e-09 AT1G79850 131 / 6e-40 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1) Lus10025799 [exp] 52 / 2e-09 AT1G79850 133 / 9e-41 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G150100 [exp] 144 / 2e-46 AT1G49400 152 / 4e-49 embryo defective 1129, Nucleic acid-binding, OB-fold-like protein (.1) Potri.006G080200 [exp] 143 / 4e-46 AT3G18880 155 / 1e-50 Nucleic acid-binding, OB-fold-like protein (.1) Potri.001G184000 [exp] 45 / 7e-07 AT1G79850 139 / 1e-42 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [flax] [poplar] OB PF00366 [flax] [poplar] Ribosomal_S17 Ribosomal protein S17
Representative CDS sequence Show only first row Show all	>Lus10028815 pacid=23177219 polypeptide=Lus10028815 locus=Lus10028815.g ID=Lus10028815.BGIv1.0 annot-version=v1.0 ATGAAATCGGTGGTGGGAGTGGTGGTTTCCAACAAGATGCAGAAATCGGTGGTGGTAGCCGTCGACAGACTCTTCCACAACAAGGTCTACAATCGCTACG TCAAGCGCACCTCGAAGTTCATGGCTCATGACATCGATGACGCATGCAACATTGGCGATCGTGTGAAATTGGATCCTTCACGGCCATTGAGCAAACACAA GTGTTGGATTGTTGCTGACATTCTTAAGAAAGCCCGCATATACATTCCTCCTTCTGCCGCTAATCCGCCTGCTGCATCAGCATCTTCAACCTCTTAA
AA sequence Show only first row Show all	>Lus10028815 pacid=23177219 polypeptide=Lus10028815 locus=Lus10028815.g ID=Lus10028815.BGIv1.0 annot-version=v1.0 MKSVVGVVVSNKMQKSVVVAVDRLFHNKVYNRYVKRTSKFMAHDIDDACNIGDRVKLDPSRPLSKHKCWIVADILKKARIYIPPSAANPPAASASSTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18880			Nucleic acid-binding, OB-fold-...		Lus10028815 [exp]	0	1
AT5G27990			Pre-rRNA-processing protein TS...		Lus10006795 [exp]	3.2	0.8432
AT2G14660			unknown protein		Lus10033766 [exp]	4.2	0.8677
AT2G44380			Cysteine/Histidine-rich C1 dom...		Lus10037470 [exp]	7.0	0.8159
AT4G40045			unknown protein		Lus10034155 [exp]	7.5	0.8051
AT4G28100			unknown protein		Lus10018524 [exp]	10.0	0.8286
AT2G46660		CYP78A6	"cytochrome P450, family 78, s...		Lus10001670 [exp]	14.1	0.7934
AT4G22320			unknown protein		Lus10032566 [exp]	16.9	0.8091
AT1G09815		POLD4	polymerase delta 4 (.1)		Lus10024978 [exp]	17.7	0.7977
AT2G31160		OBO1, LSH3	ORGAN BOUNDARY 1, LIGHT SENSIT...		Lus10024901 [exp]	20.8	0.8109
AT5G17510			unknown protein		Lus10024979 [exp]	22.6	0.7553

Compare expression of checked genes

Lus10028815 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.