Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46560 110 / 1e-33 TIM9, EMB2474 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) AT2G29530 38 / 3e-05 TIM10 Tim10/DDP family zinc finger protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017463 [exp] 128 / 8e-41 AT3G46560 156 / 2e-51 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10037964 [exp] 112 / 2e-34 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10038695 [exp] 112 / 2e-34 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10016453 [exp] 35 / 0.0003 AT2G29530 145 / 2e-47 Tim10/DDP family zinc finger protein (.1.2.3) Lus10040718 [exp] 35 / 0.0005 AT2G29530 146 / 1e-47 Tim10/DDP family zinc finger protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G039100 [exp] 115 / 7e-36 AT3G46560 154 / 1e-50 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Potri.009G039600 [exp] 34 / 0.0009 AT2G29530 141 / 1e-45 Tim10/DDP family zinc finger protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02953 [flax] [poplar] zf-Tim10_DDP Tim10/DDP family zinc finger
Representative CDS sequence Show only first row Show all	>Lus10028819 pacid=23177246 polypeptide=Lus10028819 locus=Lus10028819.g ID=Lus10028819.BGIv1.0 annot-version=v1.0 ATGTACAATTCTCTTGTGGAGAGATGCTTCGACGACTGCGTTGATAGCTTCACACGCAAGTCGCTGAATAAGCAGGAGGAGACTTGTGTGACGCGATGTG CCGAGAAGTTCTTGAGGCATTCGATGCGTGTTGGGATGAGGTTTGCTGAGCTCAACCAAGGAGCAGCCACTTCGGATGCCAAACCGTAG
AA sequence Show only first row Show all	>Lus10028819 pacid=23177246 polypeptide=Lus10028819 locus=Lus10028819.g ID=Lus10028819.BGIv1.0 annot-version=v1.0 MYNSLVERCFDDCVDSFTRKSLNKQEETCVTRCAEKFLRHSMRVGMRFAELNQGAATSDAKP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46560		TIM9, EMB2474	embryo defective 2474, Tim10/D...		Lus10028819 [exp]	0	1
AT3G25280			Major facilitator superfamily ...		Lus10025881 [exp]	8.8	0.6774
AT4G20860			FAD-binding Berberine family p...		Lus10038446 [exp]	13.6	0.6829
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Lus10026347 [exp]	13.6	0.6179
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10001009 [exp]	22.4	0.6390
AT3G05560			Ribosomal L22e protein family ...		Lus10026555 [exp]	27.7	0.6204
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10013067 [exp]	31.9	0.6270
AT2G01570	GRAS	RGA1	REPRESSOR OF GA1-3 1, REPRESSO...		Lus10014786 [exp]	41.4	0.5076
AT5G24510			60S acidic ribosomal protein f...		Lus10002680 [exp]	51.6	0.5853
AT2G26730			Leucine-rich repeat protein ki...		Lus10042135 [exp]	60.5	0.5054
AT4G25740			RNA binding Plectin/S10 domain...		Lus10014966 [exp]	84.6	0.5174

Compare expression of checked genes

Lus10028819 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.