Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25140 68 / 3e-15 OLE1, OLEO1 oleosin 1 (.1) AT2G25890 47 / 3e-07 Oleosin family protein (.1) AT3G18570 45 / 2e-06 Oleosin family protein (.1) AT5G51210 40 / 7e-05 OLEO3 oleosin3 (.1) AT1G48990 39 / 0.0002 Oleosin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017460 [exp] 106 / 3e-30 AT4G25140 136 / 9e-42 oleosin 1 (.1) Lus10027161 [exp] 94 / 3e-25 AT4G25140 154 / 3e-48 oleosin 1 (.1) Lus10031387 [exp] 93 / 4e-25 AT4G25140 164 / 1e-52 oleosin 1 (.1) Lus10010943 [exp] 96 / 5e-24 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10039683 [exp] 89 / 3e-23 AT4G25140 159 / 2e-50 oleosin 1 (.1) Lus10022141 [exp] 45 / 5e-06 AT4G25140 106 / 3e-28 oleosin 1 (.1) Lus10032461 [exp] 43 / 1e-05 AT3G18570 142 / 1e-43 Oleosin family protein (.1) Lus10042957 [exp] 41 / 4e-05 AT3G18570 139 / 2e-42 Oleosin family protein (.1) Lus10017992 [exp] 40 / 0.0001 AT3G18570 136 / 4e-41 Oleosin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G080000 [exp] 68 / 1e-15 AT4G25140 108 / 1e-30 oleosin 1 (.1) Potri.003G150600 [exp] 68 / 1e-15 AT4G25140 124 / 3e-37 oleosin 1 (.1) Potri.006G234900 [exp] 50 / 2e-08 AT2G25890 113 / 1e-32 Oleosin family protein (.1) Potri.012G059400 [exp] 42 / 1e-05 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01277 [flax] [poplar] Oleosin Oleosin
Representative CDS sequence Show only first row Show all	>Lus10028822 pacid=23177275 polypeptide=Lus10028822 locus=Lus10028822.g ID=Lus10028822.BGIv1.0 annot-version=v1.0 ATGCAGCAGCAATACCAACCTCGGTCTCGGCAGGTGGTGAAGGCCGCCACCGCCGCCACCGCCGGCGGATCCCTCCTAGTCCTCTCCGGTCTCATCCTGG CCGCCACCGTGATTTTGCTCACCATAACCACCCCTCTCCTTGTCCTCTGCAGCCCAGTTCTGGTGCCGGCTGTCATCACCGTGGGGCTCTTGATCACTGG GTTTGTCGCCTCCGGCGGGTTCGGAGTGGCTGCCATCACTGTTTTGTCCTGGATCTATAGGTACGTGAGTGGGAGGAAGGCGGTGGGAGCGGATTCACTG GAGCAAGCTCGGTCGAAGCTGACGGGGAAGGCGAGGGAGATGAAGGATAGGGCGTCGGAGTATGGACAGCAGCAGACTTCTTAA
AA sequence Show only first row Show all	>Lus10028822 pacid=23177275 polypeptide=Lus10028822 locus=Lus10028822.g ID=Lus10028822.BGIv1.0 annot-version=v1.0 MQQQYQPRSRQVVKAATAATAGGSLLVLSGLILAATVILLTITTPLLVLCSPVLVPAVITVGLLITGFVASGGFGVAAITVLSWIYRYVSGRKAVGADSL EQARSKLTGKAREMKDRASEYGQQQTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25140		OLE1, OLEO1	oleosin 1 (.1)		Lus10028822 [exp]	0	1
AT4G33860			Glycosyl hydrolase family 10 p...		Lus10033786 [exp]	2.8	0.8894
AT3G27785	MYB	PGA37, ATMYB118	PLANT GROWTH ACTIVATOR 37, myb...		Lus10013084 [exp]	3.5	0.8472
AT3G47430		PEX11B	peroxin 11B (.1)		Lus10027213 [exp]	4.6	0.8616
AT4G23700		ATCHX17	cation/H+ exchanger 17, cation...		Lus10024716 [exp]	4.9	0.8613
AT2G36270	bZIP	EEL, GIA1, ABI5	GROWTH-INSENSITIVITY TO ABA 1,...		Lus10022720 [exp]	5.8	0.8677
AT1G25480			Aluminium activated malate tra...		Lus10035037 [exp]	7.0	0.8462
AT2G46640			unknown protein		Lus10005993 [exp]	9.5	0.8585
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006307 [exp]	10.5	0.8357
					Lus10015620 [exp]	12.6	0.8401
AT2G34450			HMG-box (high mobility group) ...		Lus10025391 [exp]	15.7	0.7749

Compare expression of checked genes

Lus10028822 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.