Lus10028826 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59910 181 / 2e-58 HTB4 Histone superfamily protein (.1)
AT1G07790 179 / 8e-58 HTB1 Histone superfamily protein (.1)
AT3G45980 179 / 1e-57 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1)
AT3G46030 179 / 2e-57 HTB11 Histone superfamily protein (.1)
AT2G28720 178 / 5e-57 Histone superfamily protein (.1)
AT5G02570 177 / 5e-57 Histone superfamily protein (.1)
AT2G37470 176 / 1e-56 Histone superfamily protein (.1)
AT3G53650 174 / 6e-56 Histone superfamily protein (.1)
AT5G22880 174 / 1e-55 HTB2, H2B HISTONE H2B, histone B2 (.1)
AT3G09480 158 / 1e-49 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017456 190 / 6e-62 AT2G28720 226 / 1e-77 Histone superfamily protein (.1)
Lus10040855 183 / 3e-59 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1)
Lus10005897 181 / 2e-58 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1)
Lus10005893 181 / 2e-58 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1)
Lus10037371 180 / 8e-58 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1)
Lus10016156 179 / 9e-58 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1)
Lus10041347 179 / 1e-57 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10013544 179 / 2e-57 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10017292 179 / 2e-57 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G230701 188 / 5e-61 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
Potri.008G030400 185 / 8e-60 AT5G59910 191 / 2e-63 Histone superfamily protein (.1)
Potri.008G030500 182 / 7e-59 AT5G59910 190 / 4e-63 Histone superfamily protein (.1)
Potri.010G231300 182 / 9e-59 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.008G029900 182 / 9e-59 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.010G230600 181 / 1e-58 AT1G07790 205 / 3e-69 Histone superfamily protein (.1)
Potri.010G230801 181 / 1e-58 AT1G07790 205 / 2e-69 Histone superfamily protein (.1)
Potri.017G123700 181 / 2e-58 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.009G028001 181 / 4e-58 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.004G091200 180 / 5e-58 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10028826 pacid=23177194 polypeptide=Lus10028826 locus=Lus10028826.g ID=Lus10028826.BGIv1.0 annot-version=v1.0
ATGGCCCCCAAGGCAGAGAAGAAGCCAGCAGAGAAGAAGCCGGCAGAGAAGTCTCCGGCCGCAGCCGAGAAGAAGCCACGCGCCGAAAAGAAGTTGCCGA
AAGACGGAGGCTCCATCGACAAGAAGAAGAAGAAGGCCAAGAAGAGCGTTGAGACCTACAAGATCTACATCTTCAAGGTCCTGAAGCAGGTCCACCCAGA
CATCGGGATCTCCAGCAAGGCCATGGGGATTATGAACAGCTTCATCAACGATATCTTCGAGAAGCTCGCCCAGGAGTCTTCCAGGCTCGCCAGGTACAAC
AAGAAGCCCACCATCACGTCGAGGGAGATCCAGACTGCTGTCAGGCTTGTTCTCCCTGGAGAGCTCGCTAAGCACGCTGTCTCCGAAGGAACGAAGGCTG
TTACCAACAACTTACCTATTGTTGATCGAGTTATGTTATCTTCATCCCCAGTCTCTCAGTTTGTCTTTACTGGCTTGACGGTGTTACCAATTACTGTTTG
CAATTGCTCTGAGTCCTTCATCTTGGCTTTCTTATTGTCGAGTGGGAAATTTGGAATTTCGACAGATTTCAGTCTGGTAGGTTTAATCAGCTTCTGCTTG
GTCACTCTTATTGGTATTCGAAATCCTGGGGTTAAGGTGAAGCTGATTGAATTGCCAACATTATGCAGTTAG
AA sequence
>Lus10028826 pacid=23177194 polypeptide=Lus10028826 locus=Lus10028826.g ID=Lus10028826.BGIv1.0 annot-version=v1.0
MAPKAEKKPAEKKPAEKSPAAAEKKPRAEKKLPKDGGSIDKKKKKAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYN
KKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTNNLPIVDRVMLSSSPVSQFVFTGLTVLPITVCNCSESFILAFLLSSGKFGISTDFSLVGLISFCL
VTLIGIRNPGVKVKLIELPTLCS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28720 Histone superfamily protein (.... Lus10028826 0 1
AT1G20580 Small nuclear ribonucleoprotei... Lus10016013 1.0 0.9217
AT1G27435 unknown protein Lus10035173 2.4 0.9034
AT5G49100 unknown protein Lus10037496 9.8 0.8956
AT3G01280 VDAC1, ATVDAC1 ARABIDOPSIS THALIANA VOLTAGE D... Lus10030794 11.7 0.9093
AT5G54970 unknown protein Lus10032643 13.0 0.9124
AT2G15270 unknown protein Lus10002814 13.4 0.8926
AT5G36890 BGLU42 beta glucosidase 42 (.1.2) Lus10020232 17.3 0.8973
AT3G49660 AtWDR5a human WDR5 \(WD40 repeat\) hom... Lus10039636 18.6 0.9037
AT1G01910 P-loop containing nucleoside t... Lus10041377 19.1 0.8848
AT5G41760 Nucleotide-sugar transporter f... Lus10037204 20.1 0.8928

Lus10028826 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.