Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11290 154 / 2e-44 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G13880 88 / 4e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G21065 87 / 8e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT5G16860 86 / 2e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G15510 86 / 2e-20 VAC1, ATECB2 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G39620 84 / 6e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G33760 83 / 1e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G22690 83 / 2e-19 unknown protein AT1G19720 81 / 6e-19 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G02010 80 / 2e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017446 [exp] 207 / 1e-63 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10009487 [exp] 87 / 1e-20 AT1G71490 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10012971 [exp] 86 / 3e-20 AT1G68930 487 / 5e-163 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10039703 [exp] 82 / 3e-19 AT4G18750 394 / 6e-127 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10022125 [exp] 82 / 3e-19 AT5G11490 1337 / 0.0 adaptin family protein (.1.2) Lus10004081 [exp] 81 / 1e-18 AT3G63370 893 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10026460 [exp] 81 / 1e-18 AT1G15510 1030 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10036071 [exp] 81 / 1e-18 AT1G18485 464 / 5e-151 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10008967 [exp] 81 / 1e-18 AT4G21300 876 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G191000 [exp] 174 / 8e-52 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G215500 [exp] 97 / 1e-24 AT3G63370 922 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.011G052300 [exp] 92 / 8e-23 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G136200 [exp] 89 / 2e-21 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.013G145000 [exp] 86 / 2e-20 AT1G03540 721 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.012G041200 [exp] 84 / 5e-20 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G005700 [exp] 84 / 9e-20 AT3G49142 912 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G043400 [exp] 84 / 1e-19 AT2G33760 775 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.018G085800 [exp] 83 / 2e-19 AT4G02750 491 / 3e-164 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.019G074700 [exp] 82 / 6e-19 AT1G71490 878 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10028836 pacid=23177285 polypeptide=Lus10028836 locus=Lus10028836.g ID=Lus10028836.BGIv1.0 annot-version=v1.0 ATGAGGCACGACGGAGTTGTTTCCGTTGTGTACAATTTCGCGTATTTGTTGAAGCTCTGTGGGGATAATTCGGATCTTAAAAGGGGGAAAGAGATTCACG GGCTGCTGATTACTAGTGGGTTCTCGTGGAATTTGTTTGCGGCGACTGGGGTTGTGAATTTGTATGCGAAATGTAGGCAGATTGATAGTGCACATAAGAT GTTCGACAGAATGTCTGAGAGAGACTTGGTGTCCTGGAATACTATCGTTTCTGGGTATGCTCAGAATGGGGTTGCGAGAGTTGCATTGGGGTTGGTTTCC AAGATGTTTGGGACGGGCAGAGGCCTGATTCGATCACCATTGTTTCCGTTTTACCCGCAGCTGCTGATTTCGGGTCGTTGA
AA sequence Show only first row Show all	>Lus10028836 pacid=23177285 polypeptide=Lus10028836 locus=Lus10028836.g ID=Lus10028836.BGIv1.0 annot-version=v1.0 MRHDGVVSVVYNFAYLLKLCGDNSDLKRGKEIHGLLITSGFSWNLFAATGVVNLYAKCRQIDSAHKMFDRMSERDLVSWNTIVSGYAQNGVARVALGLVS KMFGTGRGLIRSPLFPFYPQLLISGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Lus10028836 [exp]	0	1
AT5G08305			Pentatricopeptide repeat (PPR)...		Lus10010183 [exp]	2.8	0.8018
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Lus10028837 [exp]	7.2	0.7179
AT1G07310			Calcium-dependent lipid-bindin...		Lus10018213 [exp]	11.2	0.6263
AT2G41080			Tetratricopeptide repeat (TPR)...		Lus10003324 [exp]	11.2	0.7471
AT5G56440			F-box/RNI-like/FBD-like domain...		Lus10023425 [exp]	12.7	0.7433
AT5G47460			Pentatricopeptide repeat (PPR)...		Lus10028953 [exp]	18.5	0.7236
AT5G55500		ATXYLT	"beta-1,2-xylosyltransferase",...		Lus10014902 [exp]	19.2	0.7391
AT5G16860			Tetratricopeptide repeat (TPR)...		Lus10028593 [exp]	22.1	0.7311
AT1G77170			Tetratricopeptide repeat (TPR)...		Lus10029884 [exp]	23.2	0.6494
AT1G15510		VAC1, ATECB2	VANILLA CREAM 1, ARABIDOPSIS E...		Lus10025009 [exp]	24.1	0.7375

Compare expression of checked genes

Lus10028836 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.