Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74300 140 / 2e-41 alpha/beta-Hydrolases superfamily protein (.1) AT3G48410 132 / 4e-38 alpha/beta-Hydrolases superfamily protein (.1) AT1G74280 132 / 5e-38 alpha/beta-Hydrolases superfamily protein (.1) AT1G74290 127 / 2e-36 alpha/beta-Hydrolases superfamily protein (.1) AT3G54240 120 / 6e-34 alpha/beta-Hydrolases superfamily protein (.1) AT2G36290 120 / 8e-34 alpha/beta-Hydrolases superfamily protein (.1) AT5G22460 117 / 6e-33 alpha/beta-Hydrolases superfamily protein (.1.2) AT1G08310 92 / 2e-23 alpha/beta-Hydrolases superfamily protein (.1.2) AT3G03240 88 / 8e-22 alpha/beta-Hydrolases superfamily protein (.1) AT3G44510 85 / 1e-20 alpha/beta-Hydrolases superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008968 [exp] 224 / 5e-74 AT2G36290 442 / 5e-156 alpha/beta-Hydrolases superfamily protein (.1) Lus10032809 [exp] 191 / 2e-63 AT1G74300 212 / 1e-68 alpha/beta-Hydrolases superfamily protein (.1) Lus10034148 [exp] 181 / 2e-57 AT2G36290 436 / 1e-153 alpha/beta-Hydrolases superfamily protein (.1) Lus10043437 [exp] 176 / 2e-55 AT2G36290 429 / 5e-151 alpha/beta-Hydrolases superfamily protein (.1) Lus10018549 [exp] 162 / 4e-50 AT2G36290 434 / 8e-153 alpha/beta-Hydrolases superfamily protein (.1) Lus10039775 [exp] 160 / 3e-49 AT2G36290 425 / 3e-149 alpha/beta-Hydrolases superfamily protein (.1) Lus10041666 [exp] 158 / 2e-47 AT2G36290 440 / 2e-153 alpha/beta-Hydrolases superfamily protein (.1) Lus10017051 [exp] 139 / 6e-41 AT3G48410 489 / 1e-173 alpha/beta-Hydrolases superfamily protein (.1) Lus10021371 [exp] 137 / 6e-40 AT3G48410 473 / 2e-167 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G021400 [exp] 145 / 1e-43 AT2G36290 446 / 2e-157 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G237800 [exp] 142 / 3e-42 AT2G36290 436 / 1e-153 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G237700 [exp] 139 / 5e-41 AT2G36290 452 / 6e-160 alpha/beta-Hydrolases superfamily protein (.1) Potri.008G021200 [exp] 135 / 8e-40 AT2G36290 433 / 1e-152 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G164900 [exp] 134 / 3e-39 AT5G22460 374 / 1e-129 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.008G021000 [exp] 131 / 8e-38 AT2G36290 441 / 5e-155 alpha/beta-Hydrolases superfamily protein (.1) Potri.004G203700 [exp] 119 / 2e-33 AT5G22460 434 / 2e-153 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.008G021301 [exp] 91 / 6e-25 AT1G74300 65 / 2e-13 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G164600 [exp] 93 / 1e-23 AT3G44510 440 / 5e-156 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.016G086200 [exp] 71 / 4e-15 AT5G02970 653 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028853 pacid=23177261 polypeptide=Lus10028853 locus=Lus10028853.g ID=Lus10028853.BGIv1.0 annot-version=v1.0 ATGTTACAAGAAGTTTCAGCCACGGCGGTGATCGGAATCGGAATCTTTACATGGATTCACCGATCTTTCCTCCGTCCACCTCCTCTCAACATCTGCGGCT CCCCCGGCGGACCTCCGGTCACCGCTCCCAGGATTAAGCTCCGCGACGGCCGCCACTTGGCATACAAAGAACACGGCGTCCCTAAGGAAACCGCCAACTT CAAAGTTATATTCATCCACGGATTCACCTCCAGCCGCCTCGATCCCATGATCGCCACCTCCATGTCTCAGGAAGCAATAGAGGAGCTGAGAGTCTACGCG GTGACTTTCGACAGGCCGGGTTACGGCGAGAGCGACCCGGACCCGTACGCCAAAGAGCTTGGCGTTGGATATTGA
AA sequence Show only first row Show all	>Lus10028853 pacid=23177261 polypeptide=Lus10028853 locus=Lus10028853.g ID=Lus10028853.BGIv1.0 annot-version=v1.0 MLQEVSATAVIGIGIFTWIHRSFLRPPPLNICGSPGGPPVTAPRIKLRDGRHLAYKEHGVPKETANFKVIFIHGFTSSRLDPMIATSMSQEAIEELRVYA VTFDRPGYGESDPDPYAKELGVGY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74300			alpha/beta-Hydrolases superfam...		Lus10028853 [exp]	0	1
AT2G36290			alpha/beta-Hydrolases superfam...		Lus10028854 [exp]	1.0	0.8818
AT5G53340			Galactosyltransferase family p...		Lus10032350 [exp]	8.7	0.8627
AT5G53340			Galactosyltransferase family p...		Lus10033935 [exp]	13.4	0.8791
AT1G29120			Hydrolase-like protein family ...		Lus10013909 [exp]	13.4	0.8014
AT1G06470			Nucleotide/sugar transporter f...		Lus10010954 [exp]	14.5	0.8436
AT5G05450			P-loop containing nucleoside t...		Lus10040952 [exp]	14.8	0.8721
AT5G51710		ATKEA5, KEA5	K+ efflux antiporter 5, ARABID...		Lus10031106 [exp]	15.3	0.7966
AT4G26700		ATFIM1	ARABIDOPSIS THALIANA FIMBRIN 1...		Lus10014894 [exp]	15.7	0.8014
AT5G13820		HPPBF-1, ATTBP1...	H-PROTEIN PROMOTE, telomeric D...		Lus10023406 [exp]	18.7	0.8093
AT3G24840			Sec14p-like phosphatidylinosit...		Lus10025924 [exp]	19.0	0.8262

Compare expression of checked genes

Lus10028853 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.